DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment coq-4 and Coq4

DIOPT Version :9

Sequence 1:NP_491246.4 Gene:coq-4 / 171966 WormBaseID:WBGene00000764 Length:231 Species:Caenorhabditis elegans
Sequence 2:NP_001246815.1 Gene:Coq4 / 261607 FlyBaseID:FBgn0052174 Length:268 Species:Drosophila melanogaster


Alignment Length:221 Identity:87/221 - (39%)
Similarity:131/221 - (59%) Gaps:7/221 - (3%)


- Green bases have known domain annotations that are detailed below.


 Worm    11 VPLAPLSRMLLGIGSAVTAISDPKRGDMVAAMGETT---AIGPVLENIRKRMESDVVGKRLLLEK 72
            :.::|..|:.||.||::.|:.:|:|.||:|.:||||   |:..:|:.    |::...|:|::.:|
  Fly    50 IEISPFQRLFLGAGSSIAALLNPRRHDMIACLGETTGEDALWTILDT----MQASEEGQRIMADK 110

 Worm    73 PRISNGTIDRKWLRQLPDGTLGKLYSNFLDRLNTSPDARPTVKYIDNLEHLYVMQRYRETHDFTH 137
            |||...|||.|:|..||..|.|..|..||.....:||:|..|:::::.:..|:|.||||.||..|
  Fly   111 PRIHTSTIDFKYLETLPPDTFGAAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRECHDLIH 175

 Worm   138 IALEQKTNMLGEVTVKYFEGIQYGLPMCVTGGIFGGARLLTKNRQELVDRNLPWVVEQATNARFF 202
            ..|:..|||||||.||:.|.:..|||||..|.:||..||..|.|:..:...|||.:|.....:..
  Fly   176 TVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVRLRPKQRRAYLKHYLPWALENGKRTKPL 240

 Worm   203 MAFDWENHFEKQLSEVQKELNITPLS 228
            |...||..:|:.:.|::.||.||.|:
  Fly   241 MPVYWEKRWEQNIHELRSELGITVLN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coq-4NP_491246.4 Coq4 15..227 CDD:282826 86/214 (40%)
Coq4NP_001246815.1 Coq4 54..265 CDD:282826 86/214 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162635
Domainoid 1 1.000 176 1.000 Domainoid score I2163
eggNOG 1 0.900 - - E1_COG5031
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68641
Inparanoid 1 1.050 178 1.000 Inparanoid score I2682
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54901
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004197
OrthoInspector 1 1.000 - - oto17191
orthoMCL 1 0.900 - - OOG6_103250
Panther 1 1.100 - - LDO PTHR12922
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R234
SonicParanoid 1 1.000 - - X2942
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.