DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbl2 and CG7763

DIOPT Version :9

Sequence 1:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:125 Identity:37/125 - (29%)
Similarity:64/125 - (51%) Gaps:14/125 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse   128 EKVGKK-YFVSSVKKMSLDRVKALCSEFQGSVATPRNAEE----NSAIQKVAKDIAYLGITDVRV 187
            :::|.| |::...:|::.......|.:..|.:|:.::.||    |:.:..:.:  .::.:|:...
  Fly   110 QQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR--YWIDVTNQFN 172

Mouse   188 EGSFEDLT-GNRVRYTNWNDGEPNNTGDGEDCVVI-LGNGK--WNDVPCSDSFLAICEFS 243
            |..|..:| |::..:.:|.||||  |.||| ||.| ..|||  .||..|..:...|||.|
  Fly   173 ESEFVSVTKGSKANFLSWADGEP--TKDGE-CVDIRTFNGKTTMNDNSCFANLYFICEKS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:382969 34/118 (29%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/116 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.