DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pmlr-1 and CG17168

DIOPT Version :9

Sequence 1:NP_491217.1 Gene:pmlr-1 / 171946 WormBaseID:WBGene00016323 Length:299 Species:Caenorhabditis elegans
Sequence 2:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster


Alignment Length:317 Identity:150/317 - (47%)
Similarity:196/317 - (61%) Gaps:27/317 - (8%)


- Green bases have known domain annotations that are detailed below.


 Worm     4 DSP-RDRRHRDRSPERRRRSRSRSRDRQTR---RDTRRDDSPKIKREVKEEQFSDNDSPRRRRDD 64
            ||| |...||: |..:||.:|||||:|..|   ||..|:.......:..:|::  ..||..|...
  Fly   103 DSPERSNSHRN-STRQRRNTRSRSRERSERERDRDCERNKERDYNMQSSKERW--QRSPALRHRS 164

 Worm    65 RGGRRDDR---RDNRRDDRRDHRDDRGDRDRRDNFRRPDPVREDGKQYGLEKKEEN----WGKPE 122
            |...|.:|   |..|..:||..|..:..|||....|..|..|:..:::....|.|:    |||..
  Fly   165 RSSERKNRERDRQRRPTERRPVRRSQSPRDRCHGGRDLDQRRQRNQRHNNSNKNEDDHYVWGKEV 229

 Worm   123 E---PAK-----EKEKVNLGTSGALTEDTNTFRGVVIKYNEPPEAKKPNARWRLYPFKGEESLQV 179
            :   ||:     :|||.|.|.|||||||||...|||:||:|||||:||..||||||||||.:|..
  Fly   230 DEKVPAENDVPVDKEKPNFGLSGALTEDTNKLNGVVVKYSEPPEARKPKRRWRLYPFKGETALPT 294

 Worm   180 LYIHRQSAYLIGRDHKIADIPVDHPSCSKQHAVLQFRSMPFTRDDGTKARRIMPYIIDLGSGNGT 244
            |:|||||.:|:|||.|:.|:.|||||||||||.||:|.:||.|:||:..:|:..|:|||.|.|||
  Fly   295 LHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGT 359

 Worm   245 FLNEKKIEPQRYIELQEKDMLKFGFSTREYVVMKEREITEEELAEGEDV--KKEESD 299
            |||.|||:.::|.||.|||::|||||:||||::.|   ..:|..|.:||  |.|..|
  Fly   360 FLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHE---NSKEDQEDDDVHIKDEPHD 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pmlr-1NP_491217.1 FHA 165..277 CDD:238017 72/111 (65%)
CG17168NP_001015254.1 FHA 280..395 CDD:238017 73/117 (62%)
FHA <294..411 CDD:224630 67/119 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159856
Domainoid 1 1.000 133 1.000 Domainoid score I3153
eggNOG 1 0.900 - - E1_KOG1882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134184
Inparanoid 1 1.050 259 1.000 Inparanoid score I1927
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52032
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 1 1.000 - - FOG0004489
OrthoInspector 1 1.000 - - oto17441
orthoMCL 1 0.900 - - OOG6_102703
Panther 1 1.100 - - LDO PTHR23308
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2234
SonicParanoid 1 1.000 - - X4267
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.