DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbl1 and CG7763

DIOPT Version :9

Sequence 1:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:274 Identity:59/274 - (21%)
Similarity:99/274 - (36%) Gaps:93/274 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 LLLPLLPVLLCVVSVSSSGSQTCE--DTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGK 64
            |:||     ||   :|||.|..||  ::...|:....                          |.
  Fly     8 LVLP-----LC---LSSSYSAACEGVESDSQCAAYCY--------------------------GV 38

Mouse    65 LGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILK--------------SKLQLTNK 115
            |.|  .:.|.|:               ::.::...||.:.|.:              :.|||.|:
  Fly    39 LNP--CIASMGN---------------LQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQ 86

Mouse   116 -------LHAFSMGKK----------SGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENK 163
                   .|..:||:|          ..|..::...||:.:......|.::.|.:|..::.||..
  Fly    87 NTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELD 151

Mouse   164 AIQEVATGI--AFLGITDEATEGQFMYVT-GGRLTYSNWKKDEPNNHGSGEDCVIILD-NG--LW 222
            .......|:  .::.:|::..|.:|:.|| |.:..:.:|...||...|   :||.|.. ||  ..
  Fly   152 RFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG---ECVDIRTFNGKTTM 213

Mouse   223 NDISCQASFKAVCE 236
            ||.||.|:...:||
  Fly   214 NDNSCFANLYFICE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88 5/52 (10%)
Collagen <37..89 CDD:189968 5/51 (10%)
CLECT_collectin_like 127..237 CDD:153061 31/116 (27%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 3/7 (43%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.