DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y47G6A.19 and CG32379

DIOPT Version :9

Sequence 1:NP_001379340.1 Gene:Y47G6A.19 / 171921 WormBaseID:WBGene00021645 Length:509 Species:Caenorhabditis elegans
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:390 Identity:113/390 - (28%)
Similarity:181/390 - (46%) Gaps:77/390 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm    87 FQVAIDDLHKLLIEKEGNLSTHSNDDAFFLKRL-----HDDVGFHSRLRMGEYYSYSVLSTWLER 146
            ::|.|:||..|:         |:.......|:|     |.||       :..:|::|.::.:|:.
  Fly     8 YKVLIEDLAPLV---------HAQRAENLRKKLLIQWPHIDV-------LSAFYTHSEINDYLDS 56

 Worm   147 IAENMPDIAKLIKVGTTIEGR--DILGLKFGKDTPDKKIVVIDAGIHAREWAAIHTASYFINLIV 209
            :.|..|...::.:.|.:.|.|  .:|.:..|....:|.:::||..:|||||.:...|.|.|..: 
  Fly    57 LLERFPKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQL- 120

 Worm   210 NGREEDPQIQNYLDNIVL------YIIPVLNPDGYEYTRTDKTNPRARMWRKSRSPKACAFDGVR 268
                    :.||.||..|      .|:||:|.||||||.||     :|.|||||.|.:       
  Fly   121 --------LDNYGDNQELLQDYDWVIMPVVNADGYEYTHTD-----SRYWRKSRRPTS------- 165

 Worm   269 NSCCMGVDLNRNFDFRFS-EIGASRYPCSEIYHGPSAFSEPESKAYSQFLTSLKGRLEAYITLHS 332
            |..|:|.|:||||.:.:. :.|:|..||..||.|...|.:.||:.....:...||||..|::|||
  Fly   166 NPECIGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHS 230

 Worm   333 YSQLWIYSYSHRKFTYAPDIEETRR-------VAAKAVQELGRMYGTK--YRHGTGPEIIYAFSG 388
            |...::..:.     |..|..:|.:       ..|||:     :|.|.  |.:|:...::|..||
  Fly   231 YGNYFLLPWG-----YTSDFPDTYQDMMSVADAGAKAI-----IYSTNGIYSYGSTYYVLYPTSG 285

 Worm   389 GSTDWAKETLKIKYSYTIEL-RPGYEGIIEWNGFVLDKNQLIPTAKETWAGVTVVLDEVTNQWKS 452
            .:||:|...:....:.|:|| ..|::|...|      .:|:.....|:|.||..:..||..::.|
  Fly   286 DTTDFAFGVVNATVAMTMELPAAGFQGFDPW------ISQIERLVTESWVGVRAMAAEVIRRYPS 344

 Worm   453  452
              Fly   345  344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y47G6A.19NP_001379340.1 Propep_M14 32..102 CDD:396700 5/14 (36%)
M14_CP_A-B_like 134..446 CDD:349433 99/330 (30%)
ShK 467..504 CDD:396228
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 99/330 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47975
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.