DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lron-11 and Fili

DIOPT Version :9

Sequence 1:NP_491035.1 Gene:lron-11 / 171837 WormBaseID:WBGene00022129 Length:542 Species:Caenorhabditis elegans
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:429 Identity:122/429 - (28%)
Similarity:200/429 - (46%) Gaps:47/429 - (10%)


- Green bases have known domain annotations that are detailed below.


 Worm     4 PVLILLVLVSGVIS------CQSGCKC---PTKTTAVCKGSSLRSIPILLDPRTTVLDLSNNRIS 59
            |||:||:|...::.      |.|.|:|   ...:.|:|..::|..:||.|:|.|..::|:.|||.
  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIR 86

 Worm    60 RLSADELSL--YPNLEQLILHNNSITHLSADVFSTLPSLRVLDLSSNSLLSLPNEVFSKLKNLKT 122
            .|   |.||  |..||.|.|..|.|..|.:..|.....||.|:||.|.:.||....|..|.||..
  Fly    87 TL---EFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLL 148

 Worm   123 LIISSNDVQ-LGPECFAGLSQLQTLSIADNRLSFLPPSVLKPLSGLRNLDLSANKLLSMPASVMN 186
            |.:|.|.:: :.|...:.|:.|..|.:.:|.:..|..:..|.::.|..|....|:||.:|||.:.
  Fly   149 LDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLW 213

 Worm   187 NLGGLETLKLKQNLLSSLETGMFLSQKELKHLDVSENLIGDIEEGALYGLEKLETLNLTNNQLVR 251
            :|..|::|.:..||:..:....|...|||..|.|..|::.:::..|..||..|:.|:|::|.|..
  Fly   214 HLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTM 278

 Worm   252 LPGNTWSLPALKTLDLSSNLFVSLETASFDGLPALQYLNISHSRN--------LKTIQMATFVQL 308
            :|....|       .||:..:::|....|..|||:.:||:.|.|.        |:.|....||..
  Fly   279 VPTQQLS-------KLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDN 336

 Worm   309 SSLHWLSISSS-ALTHIHPSAFNPIPPLSHLDLSNNELRYVAPGMLQWPNIRNLHLANNDWHCSC 372
            :.|..|.:::: .|:.|....|...|.:..:.:.:|.|:.:.........::.|:|.:|...|:|
  Fly   337 THLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNC 401

 Worm   373 DL---------RVSNLNPRDDAKCSGPENLAGAPINELS 402
            .|         ....::|       |.|:.||..:..|:
  Fly   402 SLLWLWRLVTGNFEGVDP-------GMEHAAGGAVAALA 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lron-11NP_491035.1 leucine-rich repeat 48..71 CDD:275380 10/24 (42%)
LRR_RI <50..177 CDD:238064 42/129 (33%)
LRR_8 70..130 CDD:290566 23/59 (39%)
leucine-rich repeat 72..95 CDD:275380 8/22 (36%)
leucine-rich repeat 96..119 CDD:275380 10/22 (45%)
LRR_8 118..177 CDD:290566 15/59 (25%)
leucine-rich repeat 120..142 CDD:275380 6/22 (27%)
LRR_RI <141..270 CDD:238064 37/128 (29%)
leucine-rich repeat 143..166 CDD:275380 5/22 (23%)
leucine-rich repeat 167..190 CDD:275380 9/22 (41%)
LRR_8 190..249 CDD:290566 18/58 (31%)
leucine-rich repeat 191..214 CDD:275380 5/22 (23%)
leucine-rich repeat 215..238 CDD:275380 7/22 (32%)
LRR_8 238..295 CDD:290566 17/56 (30%)
leucine-rich repeat 239..261 CDD:275380 7/21 (33%)
leucine-rich repeat 262..283 CDD:275380 4/20 (20%)
LRR_8 284..345 CDD:290566 17/69 (25%)
leucine-rich repeat 286..310 CDD:275380 8/31 (26%)
leucine-rich repeat 311..334 CDD:275380 5/23 (22%)
leucine-rich repeat 335..357 CDD:275380 2/21 (10%)
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 10/24 (42%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
LRR_8 120..180 CDD:404697 20/59 (34%)
leucine-rich repeat 122..145 CDD:275380 10/22 (45%)
leucine-rich repeat 146..169 CDD:275380 6/22 (27%)
LRR <161..>354 CDD:227223 55/199 (28%)
leucine-rich repeat 170..193 CDD:275380 5/22 (23%)
leucine-rich repeat 194..217 CDD:275380 9/22 (41%)
leucine-rich repeat 218..265 CDD:275380 14/46 (30%)
leucine-rich repeat 266..289 CDD:275380 8/29 (28%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
leucine-rich repeat 314..338 CDD:275380 5/23 (22%)
LRR_8 337..397 CDD:404697 11/59 (19%)
leucine-rich repeat 339..360 CDD:275380 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14510
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.