DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mark3 and CG9222

DIOPT Version :9

Sequence 1:XP_006515574.1 Gene:Mark3 / 17169 MGIID:1341865 Length:806 Species:Mus musculus
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:260 Identity:104/260 - (40%)
Similarity:156/260 - (60%) Gaps:20/260 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    60 KTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQK-LFREVRIMKILNHPNIVKLFEVIE 123
            |.||.||:||||:......|:.||:|||.|.:......|| |.||:..:|.|:|.|::..::.||
  Fly    80 KVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIE 144

Mouse   124 TEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKRIVHRDLKAENLLLDA 188
            |...:||||:.|..|.:.||:.....:.|.::|..|:|:||||:|.|.|.:||||:|.||||||.
  Fly   145 TSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDE 209

Mouse   189 DMNIKIADFGFSNEFT-------VGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTL 246
            :.|:|:.||||:.:.|       :.||  |||||..||:||:.:|..||....|:|:.||:.|.:
  Fly   210 NWNLKLIDFGFARKDTRTSDNQVILSK--TFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAM 272

Mouse   247 VSGSLPFDGQNLKELRERVLRGKYRIPF----YMSTDCENLLKRFLVLNPVK-RGTLEQIMKDRW 306
            |.|.||:||.|:..|.:|:   ...:.|    ..|::|::::..  :|.||| |..:.|:.:|.|
  Fly   273 VFGRLPYDGSNVHILLKRI---NQSLVFPKSPSASSECKHMIMH--ILAPVKIRYNIPQVKEDPW 332

Mouse   307  306
              Fly   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mark3XP_006515574.1 STKc_MARK 55..307 CDD:270974 104/260 (40%)
UBA_MARK3_4 325..367 CDD:270590
MARK1-3_C 707..804 CDD:213381
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 104/260 (40%)
S_TKc 78..332 CDD:214567 103/258 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.