DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DGUOK and nuo-4

DIOPT Version :9

Sequence 1:NP_550438.1 Gene:DGUOK / 1716 HGNCID:2858 Length:277 Species:Homo sapiens
Sequence 2:NP_741215.1 Gene:nuo-4 / 176001 WormBaseID:WBGene00019401 Length:436 Species:Caenorhabditis elegans


Alignment Length:284 Identity:64/284 - (22%)
Similarity:107/284 - (37%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    23 LEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKT-----YPEWHVATEPVATWQNIQAAG 82
            ::|:......|..:..:.:.:||||..||:|..|.|...     :||:.:....|..:.|.....
 Worm    57 IDGLKDDTRSHFHQNSKLIVVEGNIGSGKTTLAKQLADQLGFVHFPEFRMDDILVDRYGNDLRNY 121

Human    83 TQKACTAQSLGNLLDMMYREPA-RWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIFERSVYS 146
            ..|......|.: :.|.|:.|: ..|...|...|..|....|..... :|...:.| :.||:.:|
 Worm   122 YNKFPARYRLPD-ISMFYKNPSGELSAAMQDRIFNCRFDQYLNALAH-ILNTGQGV-VLERTPHS 183

Human   147 DRYIFAKNLFENGSLSDIEWHIYQDWHSFL---------LWEFASRITLHGFIYLQASPQVCLKR 202
            | ::||..:.:...:.    |.|...:.|:         .|.       |..:||......||:.
 Worm   184 D-FVFANAMRDKNYIG----HEYFKHYYFVRKNALPQLHFWP-------HLVVYLNTPTNKCLEN 236

Human   203 LYQRAREEE---------KGIELAYLEQL--HGQHEAWLIHKTTKLHFEALMNIPVLVLDVND-- 254
            :.:|...:|         |.||.:|.:.|  :..|...|.:..||..     :...:|.|:..  
 Worm   237 IKRRGNTDEIATVDERYLKTIEESYKDSLREYRNHSKILAYDWTKPG-----DTDAVVEDIERLD 296

Human   255 -DFSEEVTKQEDLMREVNTFVKNL 277
             ||.|  ....|:|.|.||.|.::
 Worm   297 LDFFE--WHSGDVMEEWNTIVDSV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DGUOKNP_550438.1 dNK 41..275 CDD:279974 61/262 (23%)
nuo-4NP_741215.1 NDUO42 74..296 CDD:238988 53/241 (22%)
AAA_33 74..261 CDD:290396 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.