DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgk3 and S6k

DIOPT Version :9

Sequence 1:NP_001362972.1 Gene:Sgk3 / 171498 RGDID:620242 Length:496 Species:Rattus norvegicus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:413 Identity:166/413 - (40%)
Similarity:235/413 - (56%) Gaps:53/413 - (12%)


- Green bases have known domain annotations that are detailed below.


  Rat   126 SDPSE------------DEDERSTPKPHSTSRNINLGP------------------------TGN 154
            |||||            |:..|.:........:::|.|                        .|.
  Fly     5 SDPSELFDLELHDLELQDDKARDSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENVNPGK 69

  Rat   155 PHAKPSDFDFLKVIGKGSFGKVLLAKRKLDG----KFYAVKVLQK-KIVLNRKEQKHIMAERNVL 214
            ....|.||:..||:|||.:|||... ||..|    |::|:|||:| .||.|:|:..|..||||: 
  Fly    70 IKLGPKDFELKKVLGKGGYGKVFQV-RKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNI- 132

  Rat   215 LKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHS 279
            |:.|||||:|.|.|:|||..|||.:|::::|||||.||:||..|.|....||.:||..|||:||.
  Fly   133 LEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHK 197

  Rat   280 IKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDW 344
            :.|:||||||||||||:.|||.|||||||||.|.....|.|||||.||:|||::.:..:...|||
  Fly   198 LGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDW 262

  Rat   345 WCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGA-KE 408
            |.|||::::||.|:|||...:..:..:.||...|||...::..|..::..|:::....|||: .|
  Fly   263 WSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPE 327

  Rat   409 DFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNA 473
            |...:|.||||:.::|.|::.:::.||..|.:...||:..||..||.: :|..   |.|.:.::.
  Fly   328 DAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQ-IPVD---SPDDTTLSE 388

  Rat   474 SVLEADDAFVGFSYAPPS--EDL 494
            |   |:..|.||:|..||  ||:
  Fly   389 S---ANLIFQGFTYVAPSILEDM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgk3NP_001362972.1 PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 10/66 (15%)
STKc_SGK3 165..490 CDD:270755 149/330 (45%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 5/10 (50%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 148/329 (45%)
STKc_p70S6K 81..402 CDD:270736 149/329 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.