DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgk2 and S6k

DIOPT Version :9

Sequence 1:NP_604458.1 Gene:Sgk2 / 171497 RGDID:620232 Length:367 Species:Rattus norvegicus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:346 Identity:165/346 - (47%)
Similarity:221/346 - (63%) Gaps:20/346 - (5%)


- Green bases have known domain annotations that are detailed below.


  Rat    18 GNINLGPSANPNARPTDFDFLKVIGKGNYGKVLLAKRKSDG----AFYAVKVLQKKSILKN-KEQ 77
            |.|.|||.        ||:..||:|||.||||... ||:.|    .::|:|||:|.||:.| |:.
  Fly    68 GKIKLGPK--------DFELKKVLGKGGYGKVFQV-RKTAGRDANKYFAMKVLKKASIVTNQKDT 123

  Rat    78 SHIMAERNVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQREHRFLEPRARFYTAE 142
            :|..||||: |:.|:|||:|.|.|:|||..|||.:|:|::|||||.||:||..|||....||.:|
  Fly   124 AHTRAERNI-LEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSE 187

  Rat   143 VASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKECVEPEETTSTFCGTPEYLAPEVLR 207
            :..|:|:||.|.||||||||||||||.||||.|||||||||.::....|.|||||.||:|||:|.
  Fly   188 IILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILT 252

  Rat   208 KEPYDRAVDWWCLGAVLYEMLHGLPPFFNTDVAQMYENILHQPLQIPGGRTVAACDLLQGLLHKD 272
            :..:.:|||||.|||::::||.|:|||...:..:..|.||...|.:|...|..|.||::.|:.:.
  Fly   253 RSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQ 317

  Rat   273 QRQRLGS-KEDFLDIKNHMFFSPINWDDLYHKRLTPPFNPNVEGPADLKHFDPEFTQEAVSKSIG 336
            :.||||| .||...::.|.||..:||||:..:||.||..|.:....|:..||..||::....|  
  Fly   318 EPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDS-- 380

  Rat   337 CTPDTMSSSSGASSAFLGFSY 357
              ||..:.|..|:..|.||:|
  Fly   381 --PDDTTLSESANLIFQGFTY 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgk2NP_604458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 5/9 (56%)
S_TKc 35..292 CDD:214567 134/262 (51%)
PKc_like 39..359 CDD:304357 158/325 (49%)
Nuclear localization signal. /evidence=ECO:0000250 68..77 5/9 (56%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 157/326 (48%)
STKc_p70S6K 81..402 CDD:270736 158/325 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.