DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mageb1 and MAGE

DIOPT Version :9

Sequence 1:NP_034889.1 Gene:Mageb1 / 17145 MGIID:105118 Length:380 Species:Mus musculus
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:207 Identity:52/207 - (25%)
Similarity:101/207 - (48%) Gaps:11/207 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse   150 DPIMRKASVLIEFLLDKFKMKEAVTRSEMLAVVNKK--YKEQFPEILRRTSARLELVFGLELKEI 212
            |.:..|...::.::||....|..:...:::||...|  .|::.|.:   |:...| .||:.|..:
  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLV---TNLLAE-TFGIILTPL 84

Mouse   213 DPSTHSYLLVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHGVGVYAGK 277
            |.:|.:::...:..:::...|:.. ..|:..||..:|..||::|||..:.:::..|..:.:|..:
  Fly    85 DATTKTFICTAEEPVASIHELTPA-QRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDE 148

Mouse   278 KHLIFGE--PEEFIRDVVRENYL--EYRQVPGSDPPSYEFLWGPRAHAETTKMKVLEVLAKVNGT 338
            :|..||.  .::.....|::.||  |..|:...|.....|||||||.||.|..::::..:|:...
  Fly   149 EHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQ 213

Mouse   339 VPSAFPNLYQLA 350
            .|..|.:...:|
  Fly   214 HPKVFGHHLSMA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mageb1NP_034889.1 MAGE_N 55..125 CDD:289225
MAGE 173..326 CDD:279759 43/158 (27%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/169 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.