DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elovl5 and CG31523

DIOPT Version :9

Sequence 1:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:281 Identity:110/281 - (39%)
Similarity:162/281 - (57%) Gaps:13/281 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 YFRALLGPR-DTRVKGWFLLDNYIPTFVCSAIYLLIV--WLGPKYMKNRQPFSCRGILVVYNLGL 72
            ::|.|:..: |.||..:|||.:.:|| :|..|:....  .|||:.|..|:|...|.:|||||...
  Fly    11 WYRDLMDNKSDPRVNDFFLLSSPLPT-LCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQ 74

  Rat    73 TLLSLYMFYELVTGVWEGKYNFFCQGT-RSAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNN 136
            |:.|.::|||.:...|.|.|:..||.. .|.....|:::.:.||||.||..||.||.||||||.|
  Fly    75 TIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKN 139

  Rat   137 HQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKK 200
            ..::.|||.||..|....|..:.:.|.|||.|.|.||||:|::||.||.:::: |..:.|:||||
  Fly   140 EHVSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKK 204

  Rat   201 YITQGQLVQFVLTIIQTSCGVIWPCSFPLGWLYFQIG-YMISLIALFTNFYIQTYNKKGASRRKE 264
            |:|..|:||||.........:...|.:|.|::.: || :.:..:.||::||...| ...|.||::
  Fly   205 YLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKY-LNAARRRRQ 267

  Rat   265 HLK--GHQNGSMTAVNGHTNN 283
            .:|  |:.|||  |.|||:.:
  Fly   268 AVKANGYANGS--ASNGHSKH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elovl5NP_599209.1 ELO 27..261 CDD:395916 94/238 (39%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 94/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.