DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magea3 and MAGE

DIOPT Version :9

Sequence 1:NP_064401.2 Gene:Magea3 / 17139 MGIID:1333832 Length:320 Species:Mus musculus
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:221 Identity:53/221 - (23%)
Similarity:106/221 - (47%) Gaps:22/221 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    73 PSEEASIKGSEGLEDPLHLLHNAQNTKVYDLVDFLVLNYQMKAFTTKAEMLENIG--REYEEYYP 135
            ||:||        :.|:.::    :.||..::::::.:...|......:::...|  .|.::..|
  Fly    15 PSQEA--------QQPVDVV----DAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLP 67

Mouse   136 LIFSEASECLKMVFGLDMVEVDSSVHTYMLVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKG 200
            |:    :..|...||:.:..:|::..|::......:.....:|..| .|:..:|..:|..||::|
  Fly    68 LV----TNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYIILMYIFLRG 127

Mouse   201 NYVSEEIIWEMLNNIGLCGGRD-PYIHKDPRKLISEEFVQEGYL--EYRQVPNSDPPSYGFLWGP 262
            |.:.:..::.||..:.:....: .|...:.||.|.|.||::.||  |..|:...|.....|||||
  Fly   128 NRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGP 192

Mouse   263 RAFAETSKMKVLQFFASINKTHPRAY 288
            ||.||.:..:::||.:.:...||:.:
  Fly   193 RAKAEFTFEQMVQFASKLLNQHPKVF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Magea3NP_064401.2 MAGE_N <44..78 CDD:372109 3/4 (75%)
MAGE 134..271 CDD:366651 39/139 (28%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842076
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.