DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magea2 and MAGE

DIOPT Version :9

Sequence 1:NP_064400.1 Gene:Magea2 / 17138 MGIID:1333793 Length:320 Species:Mus musculus
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:222 Identity:51/222 - (22%)
Similarity:104/222 - (46%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    73 PSEEASIKGSGGLEDPLYLLHNAQNTKVYDLVDFLVLNYQMKAFTTKAEMLESIG---REYEEYY 134
            ||:||        :.|:    :..:.||..:::: :|::..:....|.:.|.::.   .|.::..
  Fly    15 PSQEA--------QQPV----DVVDAKVRAILNY-ILDHTAQKIPIKDKDLIAVAGDKSELKKRL 66

Mouse   135 PLIFSEASECLKMVFGLDMVEVDPSVHSYILVTALGITYDGMMTDVLGMPKTGILIAVLSVIFMK 199
            ||:    :..|...||:.:..:|.:..::|......:.....:|.. ..|:..:|..:|..||::
  Fly    67 PLV----TNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPA-QRPQFTLLYIILMYIFLR 126

Mouse   200 GNYVSEEIIWEMVNNIGLCGGRD-PYIHKDPRKLISEEFVQEGCLKYR--QVPNSDPPSYGFLWG 261
            ||.:.:..::.|:..:.:....: .|...:.||.|.|.||::..||..  |:...|.....||||
  Fly   127 GNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWG 191

Mouse   262 PRAFAETSKMKVLQFFASINKTHPRAY 288
            |||.||.:..:::||.:.:...||:.:
  Fly   192 PRAKAEFTFEQMVQFASKLLNQHPKVF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Magea2NP_064400.1 MAGE_N <44..78 CDD:372109 3/4 (75%)
MAGE 134..271 CDD:366651 36/139 (26%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842073
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.