DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mafk and maf-S

DIOPT Version :9

Sequence 1:NP_034887.1 Gene:Mafk / 17135 MGIID:99951 Length:156 Species:Mus musculus
Sequence 2:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster


Alignment Length:99 Identity:54/99 - (54%)
Similarity:76/99 - (76%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 PVLSDDELVSMSVRELNQHL--RGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRV 84
            |.::||:|||:|||:||:.|  |||.:||:.|:||||||||||||||||||||:.||:|||.::.
  Fly    25 PDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKS 89

Mouse    85 ELQQEVEKLARENSSMRLELDALRSKYEALQTFA 118
            ....|:|::..:|..:|.|:...::||:||..||
  Fly    90 YEWTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MafkNP_034887.1 bZIP_Maf_small 46..115 CDD:269865 36/68 (53%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 51..76 21/24 (88%)
coiled coil 54..105 CDD:269865 29/50 (58%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..93 4/13 (31%)
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 36/68 (53%)
coiled coil 59..110 CDD:269865 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833881
Domainoid 1 1.000 102 1.000 Domainoid score I6813
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1770
Inparanoid 1 1.050 107 1.000 Inparanoid score I4906
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm43707
orthoMCL 1 0.900 - - OOG6_108977
Panther 1 1.100 - - LDO PTHR10129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.