DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smad6 and Mad

DIOPT Version :9

Sequence 1:NP_032568.3 Gene:Smad6 / 17130 MGIID:1336883 Length:495 Species:Mus musculus
Sequence 2:NP_001259992.1 Gene:Mad / 33529 FlyBaseID:FBgn0011648 Length:525 Species:Drosophila melanogaster


Alignment Length:391 Identity:118/391 - (30%)
Similarity:176/391 - (45%) Gaps:86/391 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   179 SLLKRLKER--SLDTLLEAVESRGGVPGGCVLVPRA---DLRLGGQPAPPQLLLGRLFRWPDLQH 238
            ||:|:||:|  :::.|..|: |..|.|..||.:||:   .|::..:...|.::..|::||||||.
  Fly   120 SLVKKLKKRKGAIEELERAL-SCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQS 183

Mouse   239 AVELKPLCGCHSFTAAADGPTVCCNPYHFSRLCGPESPP---PPYSRLSP------------PDQ 288
            ..|||||..| .:..:|....||.||||:.|:..|..||   |.:|..:|            |..
  Fly   184 HHELKPLELC-QYPFSAKQKEVCINPYHYKRVESPVLPPVLVPRHSEFAPGHSMLQFNHVAEPSM 247

Mouse   289 ----------YKPLDLSDSTLSYTETEATNSLITAP--------------------------GEF 317
                      :....||.|..|.....:.||...:|                          |:.
  Fly   248 PHNVSYSNSGFNSHSLSTSNTSVGSPSSVNSNPNSPYDSLAGTPPPAYSPSEDGNSNNPNDGGQL 312

Mouse   318 SDASMSPDA----TKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGF----------C 368
            .||.|...|    ::|:.|.|:||:|...|||.::...:.:|.:       .||          |
  Fly   313 LDAQMGDVAQVSYSEPAFWASIAYYELNCRVGEVFHCNNNSVIV-------DGFTNPSNNSDRCC 370

Mouse   369 LGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGG-RALVVRKVP 432
            ||||:...|:.::..||..||.|:.|......|:|....:..|||.|...:...| ....|.|:|
  Fly   371 LGQLSNVNRNSTIENTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIP 435

Mouse   433 PGYSIKVF-DFERSGLLQHA-----DAAHGPYDPHSVRISFAKGWGPCYSRQFITSCPCWLEILL 491
            ||.|:|:| :.|.:.||..:     :|.:......::|:||.||||..|.||.:||.|||:||.|
  Fly   436 PGCSLKIFNNQEFAQLLSQSVNNGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHL 500

Mouse   492 N 492
            :
  Fly   501 H 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smad6NP_032568.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..161
MH1_SMAD_6 161..274 CDD:199817 38/99 (38%)
MH2_SMAD_6 323..493 CDD:199824 62/191 (32%)
MadNP_001259992.1 MH1_SMAD_1_5_9 93..216 CDD:199814 38/97 (39%)
MH2_SMAD_1_5_9 325..525 CDD:199822 61/184 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3701
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.