DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc2a13 and CG33282

DIOPT Version :9

Sequence 1:NP_598295.2 Gene:Slc2a13 / 171147 RGDID:621814 Length:637 Species:Rattus norvegicus
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:508 Identity:110/508 - (21%)
Similarity:187/508 - (36%) Gaps:130/508 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat   104 LGAMWQELLVSGAVGAAAVAALAGGALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRL 168
            ||:|   |.:....|...:|.|...|     ||:..:.|.:........::..|:|...|.|.|.
  Fly    64 LGSM---LGLDSLCGNLTIAMLIERA-----GRKFCLYLMAGPYACIWILIYCASNVYYLYAARF 120

  Rat   169 VVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGL 233
            :.|...|...:.||::|:||:..|:||.|.::..|.:..|.....::.   :||   .:..:..|
  Fly   121 LCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILS---TYL---AYHVVPFL 179

  Rat   234 AAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG------NQTIDEEYDSIRNSIEEEE 292
            |.|..|..|:..:.|||:..:|::|.|...|.......|.      .||....::.:|.::..: 
  Fly   180 AIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQ- 243

  Rat   293 KEASAAGPIICRMLSYPPTRRALAVGCGLQMFQQLSGINTIMYYSATILQMSG-VEDDRLAIWLA 356
             :...|.|:..:.|:..|..:..|....|.:..|.||:.:.:.|.:.|.:.|| |.|...|..:.
  Fly   244 -QTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIII 307

  Rat   357 SITAFTNFIFTLVGVW----LVEKVGRRKLTFGSLAGTTVALTILALGFLLSAQVSPRVTFRPTA 417
            .:.       .:|||:    ||:.||||.|...|..|  |.:..:|.|                 
  Fly   308 GLV-------QIVGVYTSTILVDIVGRRVLMLISTMG--VGIGCIAFG----------------- 346

  Rat   418 PSGQNATCTEYSYCNECMLDPDCGFCYKINSSAVIDSSCVPVNKASTNEAAWGRCENETKFKAED 482
                   |..|                   .:.:.|.|                           
  Fly   347 -------CFTY-------------------LAKIYDLS--------------------------- 358

  Rat   483 VHWAYSFCPTPYSWTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVL 547
                      .::|..||.:::.......|:..:.:.|..|::|:..||...:.|.       :.
  Fly   359 ----------DFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSV-------IF 406

  Rat   548 VSLTFLHTAE----YLTYYG-AFFLYAGFAAVGLLFVYG--CLPETKGKKLEE 593
            :||....|.:    .|.|:| :|.::...|:..|.|.|.  .|.|||||.:.|
  Fly   407 LSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc2a13NP_598295.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..38
MFS 75..580 CDD:119392 102/491 (21%)
Sugar_tr 78..598 CDD:278511 110/508 (22%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 103/495 (21%)
MFS_1 53..409 CDD:284993 92/456 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.