DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angptl2 and CG31832

DIOPT Version :9

Sequence 1:NP_598253.2 Gene:Angptl2 / 171100 RGDID:620004 Length:493 Species:Rattus norvegicus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:173 Identity:74/173 - (42%)
Similarity:118/173 - (68%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Rat   316 WTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAE 380
            |.||||||||||||.::|.:||.|||:.:||:::||:.:|.:|.:..::|.:.::...|..|:|.
  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120

  Rat   381 YASFRLEPESEYYKL-RLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACA 444
            :..|:::.|:|.||| |:|:|.|.||||..:|..|:|:|.|||:|..:.|||....||||:::|.
  Fly   121 FDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCL 185

  Rat   445 HSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRP 487
            .|:|||:::|.|  .:...:|::|..::  ..||..|.:||||
  Fly   186 SSSLNGLYFREG--ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angptl2NP_598253.2 t_SNARE 156..>206 CDD:197699
FReD 273..487 CDD:238040 72/171 (42%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 74/173 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.