DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp83cd

DIOPT Version :9

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:241 Identity:52/241 - (21%)
Similarity:88/241 - (36%) Gaps:62/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LMAL-LCLTLSEFVS------------------------------KAWVMFFIFYISFTRSLSVS 40
            |:|| |||:|:|.::                              |.|...:.....|||.. :|
  Fly     8 LIALCLCLSLNEGLALLEHEGETINRCIQNYGGLTAENAERLERFKEWSDSYEEIPCFTRCY-LS 71

  Fly    41 LNMSMTRTLVPDPPNGTENKLSQEMLRACMRRTEISMSQ--------LKLFH-MSLMNSD----Y 92
            ........|.....:|......:.:..||.::.|:....        .:.|| ::.|.|.    .
  Fly    72 EMFDFYNNLTGFNKDGIVGVFGRPVYEACRKKLELPFESGESSCKHAYEGFHCITNMESHPFTVI 136

  Fly    93 NNDNDIAPTPVQSIGDVNNLGDL------DFNGNSQMPYLDLKHNEPLQCFVSCLYETLDL--DR 149
            :|..:|:|:...::.|.  |.|:      .|:..:..|.     |||:.||..|..:.|.:  ::
  Fly   137 DNMPNISPSAKDAMKDC--LQDVHQDEWKSFDAFAYYPV-----NEPIPCFTRCFVDKLHIFEEK 194

  Fly   150 YNVLLEEAFKNQVQTIIQHEKAEIKECSDLQGKTRCEAAYKLHLCY 195
            ..:...||.|..:.  |..:.|.|:.|...:|:.||...||...||
  Fly   195 TRLWKLEAMKQNLG--IPAKGARIRTCHRHRGRDRCATYYKQFTCY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 19/71 (27%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 13/99 (13%)
PhBP 149..242 CDD:214783 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.