DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp56g

DIOPT Version :9

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster


Alignment Length:144 Identity:26/144 - (18%)
Similarity:58/144 - (40%) Gaps:46/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ENKLSQEMLRACMRRTEISMSQLKLFHMSLMNSDYNNDNDIAPTPVQSIGDVNNLGDLDFNGNSQ 122
            ::.:|:|::..|::                       :|.:.|         .:|.||.   :.:
  Fly    25 DSSVSKELVTDCLK-----------------------ENGVTP---------QDLADLQ---SGK 54

  Fly   123 MPYLDLKHNEPLQCFVSC-LYETLDLDRYNVLLEEAFK-----NQVQTIIQHEKAEIKECSDLQG 181
            :...|.|.|  ::|...| |.::..:|....||.:..|     :..:.:|:   .::..||.::|
  Fly    55 VKAEDAKDN--VKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFKDVIE---KDLDRCSAVKG 114

  Fly   182 KTRCEAAYKLHLCY 195
            ...|:.|:|:..|:
  Fly   115 ANACDTAFKILSCF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 17/75 (23%)
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 25/139 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.