DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp47a

DIOPT Version :9

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:200 Identity:50/200 - (25%)
Similarity:83/200 - (41%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IFYISFTRSLSVSLNMSMTRTLVPDPPNGTENKLSQEMLRACMRRTEISMSQLKLFHMSLMNSDY 92
            :|.:|.:|...:::|:.:|   |.|....|   :::||:|.|..:|:||:.:|            
  Fly    13 MFALSESRFAKININLGLT---VADESPKT---ITEEMIRLCGDQTDISLREL------------ 59

  Fly    93 NNDNDIAPTPVQSIGDVNNLGDLDFNGNSQMPYLDLKHNEPLQCFVSCLYETLDLDRYNVLLEEA 157
                             |.|...||:..|          |.:|||..||||.:.|....|.:|..
  Fly    60 -----------------NKLQREDFSDPS----------ESVQCFTHCLYEQMGLMHDGVFVERD 97

  Fly   158 FKNQVQTIIQHEKAEIKECSDLQGKTRCEAAYKLHLCYNHLKTLEAEQRIREILERTEAENEGFG 222
            ....:..:...:....::|..::|..:||.||::|.|...||     |:.:.:|...|.| ....
  Fly    98 LFGLLSDVSNTDYWPERQCHAIRGNNKCETAYRIHQCQQQLK-----QQQQNLLATKEVE-VTTT 156

  Fly   223 PEGSD 227
            |.|||
  Fly   157 PAGSD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 18/69 (26%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.