DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp19c

DIOPT Version :9

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster


Alignment Length:164 Identity:30/164 - (18%)
Similarity:51/164 - (31%) Gaps:64/164 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PPNGTENKLS---------QEMLRA----CMRRTEISMSQLKLFHMSLMNSDYNNDNDIAPTPVQ 104
            |..|||...:         ||::.|    |:::.::                        |...:
  Fly    40 PKTGTEPIWAVIDRNLPQVQELVTAARMECIQKLQL------------------------PRDQR 80

  Fly   105 SIGDVNNLGDLDFNGNSQMPYLDLKHNEPLQCFVSCLYETLDL-DRYNVLLEEAFKNQVQTIIQH 168
            .:|.|.|                  .:|..:|.|.|:.:.:.| |..|.|.....:.....:.|.
  Fly    81 PLGKVTN------------------PSEKEKCLVECVLKKIKLMDADNKLNVGQVEKLTSLVTQD 127

  Fly   169 EKAEI-------KECS-DLQGKTRCEAAYKLHLC 194
            .|..|       :.|| .:..|..||.|:..:.|
  Fly   128 NKMAIAVSSSMAQACSRGISSKNPCEVAHLFNQC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 18/79 (23%)
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 23/139 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.