DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp56f

DIOPT Version :9

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster


Alignment Length:148 Identity:28/148 - (18%)
Similarity:54/148 - (36%) Gaps:58/148 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SQEMLRACMRRTEISMSQLKLFHMSLMNSDYNNDNDIAPTPVQSIGDVNNLGDLDFNGNSQMPYL 126
            |.|.::||::|        :|.:....|:.::...|    .:||                     
  Fly    22 SSEKIKACLKR--------QLGYTITENTKFDAKED----SLQS--------------------- 53

  Fly   127 DLKHNEPLQCFVSCLYETLDLDRYNVLLEEAFKN-QVQTIIQH----------EKAEIKECSDLQ 180
                    :||..||.|.     ..|:..:|..: |.:.:::.          |||| ::|..::
  Fly    54 --------KCFYHCLLEV-----KGVIANDAISSEQPRKVLEKKYGITDTDELEKAE-EKCHSIK 104

  Fly   181 GKTRCEAAYKLHLCYNHL 198
            ...:||..|::..||..:
  Fly   105 ASGKCELGYEILKCYQSI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 16/80 (20%)
Obp56fNP_725926.1 PBP_GOBP <52..120 CDD:279703 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.