DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp56i

DIOPT Version :9

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster


Alignment Length:109 Identity:28/109 - (25%)
Similarity:47/109 - (43%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DVNNLGDLDFNGNSQMPYLDLKHNEPLQCFVSCLYETLDLDRYNVLLEEAFKNQVQTIIQHEKAE 172
            ||.|..:.|..|:|            ::||..|..|.:.:...|.::..||...:..|:..|..|
  Fly    40 DVANRHETDDPGHS------------VKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVE 92

  Fly   173 IKE--CSDLQGKT----RCEAAYKLHLCYN--HLKTLEAEQRIR 208
            ..|  |:.::.:|    .||.|:::..||.  .|..::..||.|
  Fly    93 RMEATCNMIKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 16/75 (21%)
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.