DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83g and Obp47a

DIOPT Version :10

Sequence 1:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:93 Identity:21/93 - (22%)
Similarity:34/93 - (36%) Gaps:23/93 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 REDYYVPDDIYEKYLNYEFPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSKDLSTV 105
            |||:..|.:              ...||..|..|::.|..:.. |.||.:....:     |:|..
  Fly    64 REDFSDPSE--------------SVQCFTHCLYEQMGLMHDGV-FVERDLFGLLS-----DVSNT 108

  Fly   106 QHGLEK-CIDHNEAESDVCTWANRVFSC 132
            .:..|: |  |....::.|..|.|:..|
  Fly   109 DYWPERQC--HAIRGNNKCETAYRIHQC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83gNP_731043.1 PBP_GOBP 25..134 CDD:460193 21/93 (23%)
Obp47aNP_610632.1 PhBP 44..132 CDD:214783 20/89 (22%)

Return to query results.
Submit another query.