DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif2 and KRTAP4-4

DIOPT Version :9

Sequence 1:NP_731093.2 Gene:Pif2 / 170876 FlyBaseID:FBgn0046873 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_115913.1 Gene:KRTAP4-4 / 84616 HGNCID:16928 Length:166 Species:Homo sapiens


Alignment Length:169 Identity:76/169 - (44%)
Similarity:79/169 - (46%) Gaps:56/169 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCSPCCGSCCGP-------CCSP------CC-SPCCPPCCNDCCGSCCSP-----------CCGP 40
            |.:.||||.|..       ||.|      || :.||.|.|  |..|||.|           ||.|
Human     1 MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSC--CVSSCCRPQCCQTTCCRTTCCHP 63

  Fly    41 -CC-SPCCGP-CC-SPCCSP-CCTP-CC-TPCC-TPCCK--CCTP------CCVP-CCTP----- 83
             || |.||.| || |.||.| ||.| || |.|| |.||:  ||.|      ||.| ||.|     
Human    64 SCCVSSCCRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVS 128

  Fly    84 -CCTP-CC-TPCC-TPCCSPCCGPCCSPCCSP-CGGSKC 117
             ||.| || |.|| |.||.|.|  |.|.|..| ||.|.|
Human   129 SCCRPQCCQTTCCRTTCCRPSC--CVSRCYRPHCGQSLC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif2NP_731093.2 None
KRTAP4-4NP_115913.1 26 X 5 AA repeats of C-C-[GRQVCH]-[SPT]-[VSTQR] 5..154 68/152 (45%)
Keratin_B2_2 5..48 CDD:290596 18/44 (41%)
Keratin_B2 15..166 CDD:279797 70/155 (45%)
Keratin_B2_2 38..88 CDD:290596 24/51 (47%)
Keratin_B2_2 75..133 CDD:290596 28/57 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.