DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif2 and Krtap1-3

DIOPT Version :9

Sequence 1:NP_731093.2 Gene:Pif2 / 170876 FlyBaseID:FBgn0046873 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001078995.1 Gene:Krtap1-3 / 435273 MGIID:3650443 Length:173 Species:Mus musculus


Alignment Length:154 Identity:68/154 - (44%)
Similarity:69/154 - (44%) Gaps:49/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPCC-GSCCGP-CCSPCC--SPCCPPCCNDCCGSCCSPCCGPCCSPCCGPCCS--PCCSP-CCTP 60
            |.|| .|||.| ||.|.|  |.||.|.|  |..|||.|.|  |.|.||.||||  .||.| ||.|
Mouse    22 SSCCQPSCCQPSCCQPSCSQSSCCQPSC--CQSSCCQPSC--CQSSCCQPCCSQTSCCQPSCCQP 82

  Fly    61 -CC------------TPC----CTPCCK----CCTPCCVPCCTP--CC------TPCCTP----- 91
             ||            ..|    |.|.|:    |..||||..|||  ||      ..||.|     
Mouse    83 SCCGTGSGQEGGSGAVSCRVRWCRPDCRVEGTCLPPCCVVSCTPPTCCQLHHAQASCCRPSYCGQ 147

  Fly    92 -CCTP-CCSPCCGPCCSP--CCSP 111
             ||.| ||..||.|.||.  ||.|
Mouse   148 SCCRPACCCYCCPPSCSESNCCEP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif2NP_731093.2 None
Krtap1-3NP_001078995.1 Keratin_B2 1..154 CDD:279797 58/135 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.