DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif2 and KRTAP5-9

DIOPT Version :9

Sequence 1:NP_731093.2 Gene:Pif2 / 170876 FlyBaseID:FBgn0046873 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_005544.4 Gene:KRTAP5-9 / 3846 HGNCID:23604 Length:169 Species:Homo sapiens


Alignment Length:159 Identity:71/159 - (44%)
Similarity:78/159 - (49%) Gaps:49/159 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CSPCCGSC------CGP-CCSP--CCSP--CC-PPC-CNDC--------------CGSC-CSPCC 38
            |...||||      ||| ||:|  ||.|  || |.| |:.|              |||| ||.| 
Human    17 CDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKRGCGSCGGSKGGCGSCGCSQC- 80

  Fly    39 GPCCSPCCGPCCSPCCSPCC-TPCCTPCCTPCCKCCTPCC------VPCC-TPCCTPCCTP--CC 93
             .||.|||  |.|.|.|.|| ..||.|.|:. |.||.|||      ..|| :.||.|||:.  |.
Human    81 -SCCKPCC--CSSGCGSSCCQCSCCKPYCSQ-CSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCG 141

  Fly    94 TPCC-SPCCGPCCSP--CCSP-CGGSKCK 118
            :.|| |.||.||||.  ||.| |  .:||
Human   142 SSCCQSSCCKPCCSQSRCCVPVC--YQCK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif2NP_731093.2 None
KRTAP5-9NP_005544.4 8 X 4 AA repeats of C-C-X-P 35..162 59/131 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.