DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif2 and Y39G8B.7

DIOPT Version :9

Sequence 1:NP_731093.2 Gene:Pif2 / 170876 FlyBaseID:FBgn0046873 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_496930.1 Gene:Y39G8B.7 / 189765 WormBaseID:WBGene00012727 Length:179 Species:Caenorhabditis elegans


Alignment Length:141 Identity:37/141 - (26%)
Similarity:42/141 - (29%) Gaps:32/141 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PC-------CGS----CCGPCCSPCCSPCCPPCCNDCCGSCCSPCCGPC-------CSPCCGPCC 50
            ||       |.|    |..|...|..:..||..||.|..:.......||       |:.....|.
 Worm    22 PCIDDPDVDCASFKDDCTNPKLLPLLTQSCPVTCNLCPSTVSPTTLAPCFDDKSVNCNVFKKNCN 86

  Fly    51 SPCCSPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTPC--------CTPCCTPC------CSPCC 101
            .|...|.....|...|..|....||.....|..|...|        ||.||..|      |:..|
 Worm    87 DPDYIPMLKKFCPETCNMCPGATTPTPDSNCKDCSPNCASWAKRGFCTNCCYSCQDRERYCAKTC 151

  Fly   102 GPCCSPCCSPC 112
            |.|.:..|..|
 Worm   152 GFCSAGTCKEC 162



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.