Sequence 1: | NP_001020773.1 | Gene: | Il1rl1 / 17082 | MGIID: | 98427 | Length: | 567 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
Alignment Length: | 424 | Identity: | 88/424 - (20%) |
---|---|---|---|
Similarity: | 143/424 - (33%) | Gaps: | 133/424 - (31%) |
- Green bases have known domain annotations that are detailed below.
Mouse 6 RMGLWALAILTLPMYLTVTEGSKSSWGLENEALIVRCPQRGRSTYPV-EWYYSDTNESIPTQKRN 69
Mouse 70 RIFVSRD-RLKFLPA-RVEDSGIYACVIRSP---NLNKTGYLNVTIHKK--PPSCNIPDYLMYST 127
Mouse 128 VRGSDKNFKITCPTI--DLYNWTAPVQWFKNCKALQEPRFRA------HRSYLFIDNVTHDDEGD 184
Mouse 185 YTC----QFTHAENGTNYIVTATRSFTVEEKGFSMFPVITNPPYN-----HTMEVEIGKPASIAC 240
Mouse 241 SA------------------CFGKGSHFLADV--------LWQINK---TVVGNFGEARIQE--- 273
Mouse 274 ---------------------------------EEGRN--ESSSN---------DMDCLTSVLRI 294
Mouse 295 TGVTEKDLSLEYDCLALNLHGMIRHTIRLRRKQP 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Il1rl1 | NP_001020773.1 | Ig | 33..97 | CDD:416386 | 20/66 (30%) |
Ig strand B | 37..42 | CDD:409353 | 1/4 (25%) | ||
Ig strand C | 51..55 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 60..62 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 70..74 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 76..80 | CDD:409353 | 2/4 (50%) | ||
Ig strand F | 89..97 | CDD:409353 | 3/7 (43%) | ||
Ig2_IL1R-like | 124..210 | CDD:409415 | 20/97 (21%) | ||
Ig strand B | 135..139 | CDD:409415 | 0/3 (0%) | ||
Ig strand C | 150..154 | CDD:409415 | 0/3 (0%) | ||
Ig strand E | 170..174 | CDD:409415 | 2/3 (67%) | ||
Ig strand F | 184..189 | CDD:409415 | 2/8 (25%) | ||
Ig strand G | 201..204 | CDD:409415 | 0/2 (0%) | ||
Flexible linker. /evidence=ECO:0000250 | 204..216 | 2/11 (18%) | |||
Ig | <291..324 | CDD:416386 | 11/32 (34%) | ||
Ig strand E | 291..294 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 305..310 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 318..321 | CDD:409353 | 0/2 (0%) | ||
TIR | 385..540 | CDD:396246 | |||
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | |||
Ig | 247..327 | CDD:299845 | |||
I-set | 332..418 | CDD:254352 | |||
IGc2 | 344..407 | CDD:197706 | |||
IG_like | 432..517 | CDD:214653 | 1/2 (50%) | ||
IGc2 | 436..507 | CDD:197706 | |||
I-set | 521..610 | CDD:254352 | 26/102 (25%) | ||
IGc2 | 533..597 | CDD:197706 | 22/77 (29%) | ||
Ig | 630..699 | CDD:143165 | 15/71 (21%) | ||
IG_like | 714..802 | CDD:214653 | 17/87 (20%) | ||
Ig | 725..802 | CDD:299845 | 13/76 (17%) | ||
Ig | 823..894 | CDD:143165 | 16/71 (23%) | ||
FN3 | 906..1006 | CDD:238020 | 88/424 (21%) | ||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |