Sequence 1: | NP_032559.2 | Gene: | Cd180 / 17079 | MGIID: | 1194924 | Length: | 661 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
Alignment Length: | 327 | Identity: | 97/327 - (29%) |
---|---|---|---|
Similarity: | 142/327 - (43%) | Gaps: | 55/327 - (16%) |
- Green bases have known domain annotations that are detailed below.
Mouse 303 LDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRL--ELGTGC 365
Mouse 366 LENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFT 430
Mouse 431 RLKVKDAQSPFQNLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTL 495
Mouse 496 GRLEILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNRLTSSSIEALSHLKGI-YLNLASNRISIIL 559
Mouse 560 PSLLPILSQQRTINLRQNPLDCTCSNIYFLEWYKENMQKLED---TEDTLCENPPLLRGVRLSDV 621
Mouse 622 TL 623 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cd180 | NP_032559.2 | leucine-rich repeat | 38..57 | CDD:275380 | |
LRR 1 | 54..75 | ||||
leucine-rich repeat | 58..78 | CDD:275380 | |||
LRR 2 | 78..99 | ||||
leucine-rich repeat | 79..102 | CDD:275380 | |||
LRR 3 | 102..123 | ||||
leucine-rich repeat | 103..126 | CDD:275380 | |||
LRR 4 | 126..147 | ||||
leucine-rich repeat | 127..150 | CDD:275380 | |||
LRR 5 | 150..171 | ||||
leucine-rich repeat | 151..174 | CDD:275380 | |||
LRR 6 | 174..195 | ||||
leucine-rich repeat | 175..201 | CDD:275380 | |||
LRR 7 | 201..221 | ||||
leucine-rich repeat | 224..275 | CDD:275380 | |||
LRR 8 | 275..296 | ||||
leucine-rich repeat | 276..299 | CDD:275380 | |||
LRR 9 | 299..321 | 4/17 (24%) | |||
leucine-rich repeat | 300..322 | CDD:275380 | 4/18 (22%) | ||
LRR_8 | 321..382 | CDD:290566 | 19/62 (31%) | ||
LRR 10 | 322..343 | 7/20 (35%) | |||
leucine-rich repeat | 323..346 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | 345..>541 | CDD:238064 | 60/197 (30%) | ||
LRR 11 | 346..366 | 3/21 (14%) | |||
leucine-rich repeat | 347..371 | CDD:275380 | 4/25 (16%) | ||
LRR_8 | 371..432 | CDD:290566 | 22/60 (37%) | ||
LRR 12 | 371..391 | 9/19 (47%) | |||
leucine-rich repeat | 372..397 | CDD:275380 | 10/24 (42%) | ||
LRR 13 | 397..418 | 7/20 (35%) | |||
leucine-rich repeat | 398..421 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 420..481 | CDD:290566 | 22/60 (37%) | ||
LRR 14 | 421..442 | 7/20 (35%) | |||
leucine-rich repeat | 422..446 | CDD:275380 | 8/23 (35%) | ||
LRR 15 | 446..466 | 5/19 (26%) | |||
leucine-rich repeat | 447..470 | CDD:275380 | 8/22 (36%) | ||
LRR 16 | 470..493 | 5/22 (23%) | |||
leucine-rich repeat | 471..497 | CDD:275380 | 5/25 (20%) | ||
LRR_8 | 497..555 | CDD:290566 | 23/58 (40%) | ||
LRR 17 | 497..518 | 7/20 (35%) | |||
leucine-rich repeat | 498..521 | CDD:275380 | 8/22 (36%) | ||
LRR 18 | 521..544 | 9/22 (41%) | |||
leucine-rich repeat | 522..545 | CDD:275380 | 10/22 (45%) | ||
LRR 19 | 546..566 | 9/20 (45%) | |||
LRRCT | 577..626 | CDD:214507 | 10/50 (20%) | ||
Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | 4/18 (22%) |
leucine-rich repeat | 98..121 | CDD:275380 | 9/25 (36%) | ||
LRR_8 | 120..180 | CDD:404697 | 19/61 (31%) | ||
leucine-rich repeat | 122..145 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 146..169 | CDD:275380 | 10/24 (42%) | ||
LRR | <161..>354 | CDD:227223 | 71/236 (30%) | ||
leucine-rich repeat | 170..193 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 194..217 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 218..265 | CDD:275380 | 21/73 (29%) | ||
leucine-rich repeat | 266..289 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 290..313 | CDD:275380 | 9/27 (33%) | ||
leucine-rich repeat | 314..338 | CDD:275380 | 7/34 (21%) | ||
LRR_8 | 337..397 | CDD:404697 | 5/19 (26%) | ||
leucine-rich repeat | 339..360 | CDD:275380 | 4/17 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |