Sequence 1: | NP_032559.2 | Gene: | Cd180 / 17079 | MGIID: | 1194924 | Length: | 661 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729599.1 | Gene: | CG32055 / 39188 | FlyBaseID: | FBgn0052055 | Length: | 534 | Species: | Drosophila melanogaster |
Alignment Length: | 389 | Identity: | 105/389 - (26%) |
---|---|---|---|
Similarity: | 153/389 - (39%) | Gaps: | 110/389 - (28%) |
- Green bases have known domain annotations that are detailed below.
Mouse 297 FSGLQELDLTATHLSEL-------PSGLVG--------LSTLKKL------VLSANKFENLCQIS 340
Mouse 341 ASNFPSLTHLSIKGNTKRLELGTGCLENL-----ENLRELDLSHDDIETSDCCNLQL-------- 392
Mouse 393 --------------RNLSHLQSLNLSYNEPLSLKTEAFK---ECPQLELLDLAFTRLKVKDAQSP 440
Mouse 441 FQNLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGN-------------------HFPKGNI 486
Mouse 487 QKTNSLQTLGRLEILVLSFCDLS-----------------------------SIDQHAFTSLKMM 522
Mouse 523 NHVDLSHNRLTSSSIEALSHLKGI-YLNLASNRISIILPSLLPI--LSQQRTINLRQNPLDCTC 583 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cd180 | NP_032559.2 | leucine-rich repeat | 38..57 | CDD:275380 | |
LRR 1 | 54..75 | ||||
leucine-rich repeat | 58..78 | CDD:275380 | |||
LRR 2 | 78..99 | ||||
leucine-rich repeat | 79..102 | CDD:275380 | |||
LRR 3 | 102..123 | ||||
leucine-rich repeat | 103..126 | CDD:275380 | |||
LRR 4 | 126..147 | ||||
leucine-rich repeat | 127..150 | CDD:275380 | |||
LRR 5 | 150..171 | ||||
leucine-rich repeat | 151..174 | CDD:275380 | |||
LRR 6 | 174..195 | ||||
leucine-rich repeat | 175..201 | CDD:275380 | |||
LRR 7 | 201..221 | ||||
leucine-rich repeat | 224..275 | CDD:275380 | |||
LRR 8 | 275..296 | ||||
leucine-rich repeat | 276..299 | CDD:275380 | 1/1 (100%) | ||
LRR 9 | 299..321 | 10/36 (28%) | |||
leucine-rich repeat | 300..322 | CDD:275380 | 11/36 (31%) | ||
LRR_8 | 321..382 | CDD:290566 | 20/71 (28%) | ||
LRR 10 | 322..343 | 7/26 (27%) | |||
leucine-rich repeat | 323..346 | CDD:275380 | 8/28 (29%) | ||
LRR_RI | 345..>541 | CDD:238064 | 67/273 (25%) | ||
LRR 11 | 346..366 | 5/19 (26%) | |||
leucine-rich repeat | 347..371 | CDD:275380 | 7/28 (25%) | ||
LRR_8 | 371..432 | CDD:290566 | 21/85 (25%) | ||
LRR 12 | 371..391 | 6/19 (32%) | |||
leucine-rich repeat | 372..397 | CDD:275380 | 7/46 (15%) | ||
LRR 13 | 397..418 | 7/23 (30%) | |||
leucine-rich repeat | 398..421 | CDD:275380 | 8/25 (32%) | ||
LRR_8 | 420..481 | CDD:290566 | 25/79 (32%) | ||
LRR 14 | 421..442 | 9/20 (45%) | |||
leucine-rich repeat | 422..446 | CDD:275380 | 11/23 (48%) | ||
LRR 15 | 446..466 | 4/19 (21%) | |||
leucine-rich repeat | 447..470 | CDD:275380 | 7/22 (32%) | ||
LRR 16 | 470..493 | 12/41 (29%) | |||
leucine-rich repeat | 471..497 | CDD:275380 | 13/44 (30%) | ||
LRR_8 | 497..555 | CDD:290566 | 17/87 (20%) | ||
LRR 17 | 497..518 | 7/49 (14%) | |||
leucine-rich repeat | 498..521 | CDD:275380 | 8/51 (16%) | ||
LRR 18 | 521..544 | 5/22 (23%) | |||
leucine-rich repeat | 522..545 | CDD:275380 | 6/22 (27%) | ||
LRR 19 | 546..566 | 7/22 (32%) | |||
LRRCT | 577..626 | CDD:214507 | 4/7 (57%) | ||
CG32055 | NP_729599.1 | leucine-rich repeat | 76..99 | CDD:275380 | 1/1 (100%) |
leucine-rich repeat | 100..123 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 128..180 | CDD:290566 | 13/56 (23%) | ||
leucine-rich repeat | 128..147 | CDD:275380 | 3/18 (17%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 7/27 (26%) | ||
leucine-rich repeat | 172..192 | CDD:275380 | 5/19 (26%) | ||
LRR_RI | <187..400 | CDD:238064 | 52/214 (24%) | ||
LRR_8 | 192..251 | CDD:290566 | 13/58 (22%) | ||
leucine-rich repeat | 193..216 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 217..240 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 241..267 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 268..291 | CDD:275380 | 11/23 (48%) | ||
LRR_8 | 290..350 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 292..315 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 316..339 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 340..400 | CDD:290566 | 11/60 (18%) | ||
leucine-rich repeat | 340..365 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 366..389 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 390..413 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 391..448 | CDD:290566 | 13/56 (23%) | ||
leucine-rich repeat | 414..437 | CDD:275380 | 6/22 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |