DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zscan5b and CG31441

DIOPT Version :9

Sequence 1:NP_573467.2 Gene:Zscan5b / 170734 MGIID:2159640 Length:468 Species:Mus musculus
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:465 Identity:92/465 - (19%)
Similarity:146/465 - (31%) Gaps:182/465 - (39%)


- Green bases have known domain annotations that are detailed below.


Mouse    52 IQDLRSISELC------YQWLRPDLNSK---------EEILDQLVLE-----QFLICMPPEQQAL 96
            :.:||||...|      .|.....|.:|         |.|.| :.||     ..|||        
  Fly     1 MSELRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITD-MYLEFDTTLPHLIC-------- 56

Mouse    97 VKESGVKSCK-DLEKLLRDRKR----HNWSIIYSQGQAHLLR----------HPSVGKAEAAEDK 146
                  :.|| .|:::|..|.:    |.   .:......|||          .|.|.|.:  :|.
  Fly    57 ------QCCKVQLDRILTFRNKCLEVHK---SFMAANRKLLRKKAIVDEELDKPDVEKLQ--QDL 110

Mouse   147 WGHTD-------------FSQEHLSNE---SEESLNRGQASRELQNLSETEEPSTSQEEGILLGV 195
            |.|||             ..::|..||   ..|...:.:.::|.|...:|||....||:...:.:
  Fly   111 WDHTDQEMCVAMADTAGLLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQEQLHNMSI 175

Mouse   196 IPERRQPDYLRPEMSPGSDSVPDLEEAEASVFVGQDPLPALGPAGSLGVKGAVQPQEDTVVDAVP 260
            |                                                                
  Fly   176 I---------------------------------------------------------------- 176

Mouse   261 SFTHILERDLALNRDLQSLSGFNLPTSQGVASYMGNTEDGLEAANPEPANPQPEKQVDSLAGQAR 325
                                      |:||::.:                |:..|:     ....
  Fly   177 --------------------------SKGVSARV----------------PKRTKR-----NSKS 194

Mouse   326 FQCTECKKSFLYKSRFDLHQRSHTGERPFKCILCNKAFVQSSDLRVHQRVHTGEKPYMCEVCGME 390
            :.|.:|...|...:...||.:.|:|.:||.|.:|...:...:::|.|:.:||..:||.|..|...
  Fly   195 WFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKT 259

Mouse   391 FAHGSTLQGHSRVHTKEKPFVCKDCGQRFCHKGNLNVHFRIHCNLRPYVCKKCNKTFRQQGTWKR 455
            :...|:...|.|.||.|:||.|:.|.:.|........|..:|.|.|.|.|:.|::.|.:......
  Fly   260 YRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTL 324

Mouse   456 HMKTHLRKRK 465
            |..|.|.:|:
  Fly   325 HQSTKLHQRR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zscan5bNP_573467.2 SCAN 33..117 CDD:153421 21/85 (25%)
C2H2 Zn finger 328..348 CDD:275368 5/19 (26%)
zf-H2C2_2 344..365 CDD:372612 7/20 (35%)
C2H2 Zn finger 356..376 CDD:275368 4/19 (21%)
zf-H2C2_2 368..393 CDD:372612 8/24 (33%)
C2H2 Zn finger 384..404 CDD:275368 5/19 (26%)
zf-H2C2_2 397..419 CDD:372612 9/21 (43%)
zf-C2H2 410..432 CDD:333835 5/21 (24%)
C2H2 Zn finger 412..432 CDD:275368 4/19 (21%)
zf-C2H2 438..460 CDD:333835 5/21 (24%)
C2H2 Zn finger 440..460 CDD:275370 4/19 (21%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 19/92 (21%)
COG5048 <174..337 CDD:227381 48/272 (18%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 268..290 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
C2H2 Zn finger 309..328 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.