DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papln and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001192272.1 Gene:Papln / 170721 MGIID:2386139 Length:1302 Species:Mus musculus
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:199 Identity:46/199 - (23%)
Similarity:74/199 - (37%) Gaps:65/199 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse  1072 PGVVDA--------SPGQRIRLTCRAEGFPVPTIEWQRD--GQLVSSPR---HQVQPDGSLVISR 1123
            |.:.||        ..|..:.|.|:|:|.|.|||:|:||  .::|.:..   |.::.| ||.:.|
  Fly   157 PNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETD-SLELER 220

Mouse  1124 VDVEDGGYYSCVAFNGQDRDQRWVQLRVLRELTITGLPPAVT---------------------VA 1167
            :.....|.|.|:|.|                    |:||:|:                     :.
  Fly   221 ISRLHMGAYLCIASN--------------------GVPPSVSKRIKVSVDFSPMVWIPHQLVGIP 265

Mouse  1168 EGDTARLLCVVAGESVNIR-WSRNGLPIQADGHRV-------HQSPDGT--LLIHNLRPRDEGSY 1222
            .|....|.|.:.....::. |:|....:..:..:.       |.|...|  |.|.|::..|.|:|
  Fly   266 IGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNY 330

Mouse  1223 TCSA 1226
            .|.|
  Fly   331 KCVA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAM_spacer1 184..299 CDD:368694
TSP1 309..362 CDD:214559
TSP1 389..447 CDD:214559
TSP1 447..504 CDD:214559
TSP1 511..562 CDD:214559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..737
Kunitz_BPTI 771..822 CDD:333766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..924
Papilin_u7 831..922 CDD:374683
Ig 932..>995 CDD:386229
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1024..1064
I-set 1070..1141 CDD:369462 26/81 (32%)
Ig 1157..1241 CDD:386229 20/101 (20%)
PLAC 1257..1289 CDD:370061
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 27/104 (26%)
IGc2 172..237 CDD:197706 23/85 (27%)
IG_like 267..348 CDD:214653 16/68 (24%)
Ig 270..339 CDD:299845 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.