DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and CG32026

DIOPT Version :9

Sequence 1:NP_570954.1 Gene:Idh3b / 170718 MGIID:2158650 Length:384 Species:Mus musculus
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:372 Identity:137/372 - (36%)
Similarity:221/372 - (59%) Gaps:24/372 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 ARNSGAWRGLGTSTAHAASQSQAQDVRVEGAFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFKE 81
            |...|...|.|..:..|:.:.:.          :|::||||:|||:..||.::.:||..|:.|:.
  Fly   362 AGGQGQKGGAGGKSGKASGEPRV----------ITLMPGDGIGPEISMAVIKILEAAKTPLIFEP 416

Mouse    82 HHLSEVQNMASEEKL-EQVLSSMKENKVAIIGKIYTPMEYKGE-LASYDMQLRRKLDLFANVVHV 144
            ..::.|.|......: |||:.||...||.:.|.:.||:   |. ..|.::.||:..:|:||:...
  Fly   417 VDVTPVLNSQGMTSVPEQVIESMNRTKVGLKGPLMTPV---GTGFRSLNLTLRQLFNLYANIRPC 478

Mouse   145 KSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESAKGVIECLKIVTRTKSQRIAKFAFDYATKKGR 209
            :||||.:|.:.::|:|.|||.||||||.:||....||::.:|::||..|.|:|::.|.||....|
  Fly   479 RSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKR 543

Mouse   210 SKVTAVHKANIMKLGDGLFLQCCEEVAELYPK------IKFETMIIDNCCMQLVQNPYQFDVLVM 268
            .|||||.::.:|::.|||||:|..|:|..|..      ||:|...:...|:.:||:|.::|:||:
  Fly   544 KKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVL 608

Mouse   269 PNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAV-GRNIANPTAMLLSATNML 332
            |||||:||.:..|||:||.|:.|..:.....|:||  :.|..|..: |:::|||||:|||:..||
  Fly   609 PNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAIFE--SVHGTAPDIAGKDLANPTALLLSSVMML 671

Mouse   333 RHLNLEYHSSMIADAVKKVIKAGKVRTRDMGGYSTTTDFIKSVIGHL 379
            .::.|..|:..|..||.|.|:...:||.|:||.:..:::..::|.:|
  Fly   672 HYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKCSEYTDALIKNL 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_570954.1 Iso_dh 46..379 CDD:351095 131/341 (38%)
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 131/350 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.