| Sequence 1: | XP_011238330.1 | Gene: | Kirrel / 170643 | MGIID: | 1891396 | Length: | 805 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
| Alignment Length: | 200 | Identity: | 51/200 - (25%) |
|---|---|---|---|
| Similarity: | 79/200 - (39%) | Gaps: | 42/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 63 TVVAGQRAVLPCVLLNYSGI----VQWT-------KDGLALGMGQGLKA-WPRYRVVGSADAGQY 115
Mouse 116 NLEITDAELSDDASYECQ-ATEAALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFN 179
Mouse 180 A-KPAATIIWFRDGTQQEGAVTSTELLK--DGKRETTI---------SQLLI-EPTDLDIGRVFT 231
Mouse 232 CRSMN 236 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kirrel | XP_011238330.1 | Ig | 54..148 | CDD:386229 | 25/97 (26%) |
| Ig2_KIRREL3-like | 170..251 | CDD:143236 | 19/79 (24%) | ||
| Ig | 255..336 | CDD:386229 | |||
| Ig_3 | 340..421 | CDD:372822 | |||
| Ig5_KIRREL3 | 439..536 | CDD:143306 | |||
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 25/97 (26%) |
| Ig_3 | 193..271 | CDD:404760 | 20/88 (23%) | ||
| Ig strand B | 204..208 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 250..254 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 264..269 | CDD:409353 | 2/5 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||