DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr17

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:255 Identity:67/255 - (26%)
Similarity:104/255 - (40%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 TVVAGQRAVLPCVLLNYSG-IVQWT--KDGLALGMGQ-GLKAWPRYRVVGSADAG-QYNLEITDA 122
            |...|..|.:||.:...|. .|.|.  :|...:.:.: ...|..|::.:...|.. .::|:|...
  Fly   416 TAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYV 480

Mouse   123 ELSDDASYECQ-ATEAALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFNA-KPAAT 185
            |.||...|||| |||..|   .||:.:.|...:|.:.|.....::||:...|.|..... .|...
  Fly   481 EPSDAGWYECQMATEPKL---SAKVHLQIV
KPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKY 542

Mouse   186 IIWFR------DGTQQEGAVTSTELLKD-----GKRETTISQLLIEPTDLDIGRVFTCRSMNEAI 239
            |||||      |..::.|  ..|:|.::     |..:.||..|:|.....:....:||:..|   
  Fly   543 IIWFRGQKKISDSDERTG--WYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSN--- 602

Mouse   240 PNGKETSIELDVH-----HPPTVTLSIEPQTVLEGERVIFTCQATAN-PEILGYRWAKGG 293
                ..|:.:|:|     :..:..:|...:|...|..   ||.:|.. ..|||..||..|
  Fly   603 ----SVSVSVDLHV
LSGEYSASAIMSTAARTTKGGRS---TCHSTLGLLGILGLLWAMQG 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 27/90 (30%)
Ig2_KIRREL3-like 170..251 CDD:143236 21/92 (23%)
Ig 255..336 CDD:386229 12/40 (30%)
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 19/74 (26%)
Ig 415..507 CDD:299845 27/93 (29%)
IG_like 521..612 CDD:214653 24/99 (24%)
IGc2 524..605 CDD:197706 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.