DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel1 and nrm

DIOPT Version :10

Sequence 1:XP_011238330.1 Gene:Kirrel1 / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster


Alignment Length:676 Identity:141/676 - (20%)
Similarity:223/676 - (32%) Gaps:210/676 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 VAYLIFVTLALALPGTQTRFSQEPADQTV--VAGQRAVLPCVL----------LNYSGIVQWTK- 87
            ::..:.:.|.|||..:.|    ...|.|:  ...|..||||.:          ||      |.| 
  Fly    25 ISLSLVLVLCLALVDSST----AQVDTTISQQESQSVVLPCPVDAEKCGKLHSLN------WFKG 79

Mouse    88 -DGLA---LGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQAT-----EAA--LRS 141
             |.:|   ||..........:....:.:...|.|.|.|.:::|:..|.|..|     |..  ...
  Fly    80 DDRIAAMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFIPEETCDNFNG 144

Mouse   142 RRAKLTVLIPPEET--------RIDGGPVI-LLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEG 197
            .|.:|.||:||.|.        ||..|.|: .:|.......||...|.:|...:.||| ||::..
  Fly   145 YRIELRVLVPPTEVVILDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQPEVSWFR-GTKRLT 208

Mouse   198 AVTSTELLKDGKRETTIS---------------------------------QLLIEPTDLDIG-- 227
            ..:.|..|.||...:|:.                                 .|.:.||.:||.  
  Fly   209 TYSPTHDLVDGLYTSTLELDWTLSREDLAQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGV 273

Mouse   228 ----------------------------------------------------------------- 227
                                                                             
  Fly   274 KHHTVQGSKVVLTCDIHGARPAVNLTWYNTTTIISSGENEITEVRSKSLEKSDGTFHTQSELIFN 338

Mouse   228 -------RVFTCRSMNEAIPNGKE----TSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATAN 281
                   |||.|.:.|..:...:|    :::.|:|.:||.|.:|....|....|.|:..|:..||
  Fly   339 ATRFENDRVFRCEAENIVLQINREKPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFAN 403

Mouse   282 P-EILGYRWAKGGFLIEDAHESRYETN-------VDYSFFTEPV---SCEVYNKVGSTNVSTLVN 335
            | .:....|.:...|:.....:.|:..       |..|...|.:   ||::.|.:|.......:|
  Fly   404 PASLTQVEWYRNDILVNVNDTTHYKGGNSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKIN 468

Mouse   336 --VHFAP--RIVVYPK-PTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRLPGSPPEANLSA 395
              |.:||  .|::.|: |......|:|||.|..:...|..||..:..:|  ..|....|:...:.
  Fly   469 LDVQYAPTVEILMIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWYAN--STLLKELPDCEETR 531

Mouse   396 QVLS--NSNQLLLKSVTQADAGTYTCRAI-----VPRIGVAEREVPLYVNGPPIISSEAVQFAVR 453
            :.|.  :.::|||:|:.:.....|:|...     .||  ..::|:.::....|...|.....||:
  Fly   532 EDLCHIDPSKLLLESIGRGFFYNYSCEGFNAAGWGPR--SEDKELLVHYEPGPAALSHFPLVAVK 594

Mouse   454 GDGGKVECFIGST--PPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTL-----TINNVME 511
            .......|.:...  |..:|..|                   ...|.|.|..:     |:..| .
  Fly   595 KKSVTFSCSVDDPGFPESNRFRW-------------------LRGGRGPLQDIVTKDWTVEPV-G 639

Mouse   512 ADFQTHYNCTAWNSFGPGT-AIIQLE 536
            .|.:|:|:|.|:|..|.|. |.:.||
  Fly   640 LDSRTNYSCYAYNEGGKGVMATVNLE 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel1XP_011238330.1 Ig 54..148 CDD:472250 26/117 (22%)
Ig strand B 70..74 CDD:409353 2/3 (67%)
Ig strand C 83..86 CDD:409353 0/2 (0%)
Ig strand E 110..119 CDD:409353 2/8 (25%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig strand G 141..144 CDD:409353 0/2 (0%)
IgI_2_KIRREL3-like 154..251 CDD:409416 32/216 (15%)
Ig strand A 155..158 CDD:409416 1/10 (10%)
Ig strand A' 161..165 CDD:409416 1/4 (25%)
Ig strand B 172..179 CDD:409416 2/6 (33%)
Ig strand C 184..189 CDD:409416 0/4 (0%)
Ig strand C' 192..194 CDD:409416 1/1 (100%)
Ig strand D 197..204 CDD:409416 1/6 (17%)
Ig strand E 211..219 CDD:409416 2/40 (5%)
Ig strand F 228..236 CDD:409416 4/7 (57%)
Ig strand G 242..248 CDD:409416 1/9 (11%)
Ig_3 254..>314 CDD:464046 16/67 (24%)
Ig_3 340..421 CDD:464046 22/85 (26%)
IgI_5_KIRREL3 439..536 CDD:409479 22/104 (21%)
Ig strand A 440..444 CDD:409479 1/3 (33%)
Ig strand A' 446..449 CDD:409479 0/2 (0%)
Ig strand B 457..464 CDD:409479 1/6 (17%)
Ig strand C 471..476 CDD:409479 2/4 (50%)
Ig strand C' 478..481 CDD:409479 0/2 (0%)
Ig strand D 489..496 CDD:409479 0/6 (0%)
Ig strand E 499..506 CDD:409479 2/11 (18%)
Ig strand F 517..524 CDD:409479 3/6 (50%)
Ig strand G 527..534 CDD:409479 3/7 (43%)
nrmNP_001246890.1 V-set 44..152 CDD:462230 26/113 (23%)
Ig strand B 183..187 CDD:409353 0/3 (0%)
Ig <185..248 CDD:472250 14/63 (22%)
Ig strand C 197..201 CDD:409353 0/3 (0%)
Ig strand E 225..229 CDD:409353 0/3 (0%)
Ig strand F 239..244 CDD:409353 0/4 (0%)
Ig strand G 253..256 CDD:409353 0/2 (0%)
Ig 277..354 CDD:472250 4/76 (5%)
Ig strand B 283..287 CDD:409353 0/3 (0%)
Ig strand C 297..301 CDD:409353 0/3 (0%)
Ig strand E 333..337 CDD:409353 0/3 (0%)
Ig strand F 347..352 CDD:409353 3/4 (75%)
Ig_3 376..456 CDD:464046 19/79 (24%)
Ig 676..779 CDD:472250
Ig strand B 689..693 CDD:409353
Ig strand C 702..706 CDD:409353
Ig strand E 734..741 CDD:409353
Ig strand F 762..767 CDD:409353
Ig <811..869 CDD:472250
Ig strand C 820..824 CDD:143205
Ig strand F 849..854 CDD:143205
Ig strand G 862..865 CDD:143205
PTZ00112 1747..>1940 CDD:240274
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.