DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr10

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:278 Identity:65/278 - (23%)
Similarity:92/278 - (33%) Gaps:100/278 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    59 PADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYR-----VVGS--------- 109
            |.:.|.:.|:.|.|.|.:.:               :|....||.|:|     .||:         
  Fly    60 PRNITSLVGKSAYLGCRVKH---------------LGNKTVAWIRHRDLHILTVGTYTYTTDQRF 109

Mouse   110 -----ADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTV--LIPPE-------------- 153
                 .|..::.|:|..|:..|...||||.:...:||....|.:  ||..|              
  Fly   110 QTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAF 174

Mouse   154 ---ETR-------------------------IDGGPVILLQAGTPYNLTC-RAFNAKPAATIIWF 189
               |.|                         |.|||.:.:..|:..|||| ..|:.:|...|.|:
  Fly   175 YIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWY 239

Mouse   190 -RDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHH 253
             :|....|.........|..|.|.|.|.|||...||.....::|...|..|.:       :.|| 
  Fly   240 HQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIAS-------IRVH- 296

Mouse   254 PPTVTLSIEPQTVLEGER 271
                        ||:|||
  Fly   297 ------------VLQGER 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 25/107 (23%)
Ig2_KIRREL3-like 170..251 CDD:143236 23/82 (28%)
Ig 255..336 CDD:386229 5/17 (29%)
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
dpr10NP_729591.1 Ig 63..143 CDD:299845 21/94 (22%)
IG_like 210..297 CDD:214653 27/106 (25%)
IGc2 217..287 CDD:197706 22/69 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.