DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and ImpL2

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:257 Identity:53/257 - (20%)
Similarity:88/257 - (34%) Gaps:76/257 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse   241 NGKETSIELDVHHPPTVTLSIE-------PQTVL---EGERVIFTCQATANPEILGYRWAKGGFL 295
            |..:.|||.:...|.......:       |.|.|   :|..:...|:...: ::...:|..|   
  Fly    35 NDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGS-QVPSIQWVVG--- 95

Mouse   296 IEDAHESRYE-----------------TNVDYSFFTEPVSCE--VYNKVGSTN-----VSTLVNV 336
                |..|.|                 ..|..|...:.|..|  .|..||.|.     .||:|:.
  Fly    96 ----HLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHP 156

Mouse   337 HFAPRI-------------VVYPKPTTTDI-GSDVTLTCVWVGNPPLTLTWTKKDSN---MGPRL 384
            ..:.|:             ::|.:.|..|: ||::.|.|.....|...:||...::.   .|.| 
  Fly   157 PRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHR- 220

Mouse   385 PGSPPEANLSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSE 446
                      .:||:|.: ||:..:...|.|.|.|   :.|..|.:.....:|.  |:::.|
  Fly   221 ----------HRVLANGD-LLISEIKWEDMGNYKC---IARNVVGKDTADTFVY--PVLNEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229
Ig2_KIRREL3-like 170..251 CDD:143236 4/9 (44%)
Ig 255..336 CDD:386229 21/114 (18%)
Ig_3 340..421 CDD:372822 22/97 (23%)
Ig5_KIRREL3 439..536 CDD:143306 2/8 (25%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.