DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and babos

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:160 Identity:40/160 - (25%)
Similarity:60/160 - (37%) Gaps:46/160 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   316 PVSCEVYNKVGSTNVSTLVNVHFAPRIVVYPKPTTTDI-GSDVTLTCVWVG----NPPLTLTWTK 375
            ||:.|..||       ||               :.|.| |.||.|.|. ||    :..:.:.|..
  Fly    59 PVASEKINK-------TL---------------SVTGIRGEDVVLKCD-VGSNLHSSDVVVLWYF 100

Mouse   376 KDS--NMGPRL--PGSPPEANLSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLY 436
            .|:  :.|..|  |....:||....:|..|.|:         ||:|.|: ::|...|...:|.:.
  Fly   101 GDNVISNGKNLVQPNFKLDANYDLTILKASPQV---------AGSYLCK-VLPSGSVVNTKVTIA 155

Mouse   437 VNGPPIISSEAVQFAVRGDGGKVECFIGST 466
            .:....|:.|:...|    .|....|:|.|
  Fly   156 EHSLDAIAPESSTSA----AGSASSFLGCT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229
Ig2_KIRREL3-like 170..251 CDD:143236
Ig 255..336 CDD:386229 7/19 (37%)
Ig_3 340..421 CDD:372822 23/89 (26%)
Ig5_KIRREL3 439..536 CDD:143306 7/28 (25%)
babosNP_001286719.1 ig 70..154 CDD:278476 26/94 (28%)
IG_like 70..154 CDD:214653 26/94 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.