DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and Strn-Mlck

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster


Alignment Length:825 Identity:175/825 - (21%)
Similarity:272/825 - (32%) Gaps:265/825 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    59 PADQTVVAGQRAVLPCVLLNYSGI----VQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEI 119
            |.....:.|....|.|   |..|.    |.|.|||:.|...   ....:.|.:||..|    |.|
  Fly  6328 PGQAKALLGSSFTLQC---NMRGAPRPQVTWFKDGIQLSSS---SERVKIRQIGSTCA----LTI 6382

Mouse   120 TDAELSDDASYECQATEAALR-SRRAKLTVL----IPPEETRI-------------DGGPVILL- 165
            ......|...|.|:||.:..| |..|:|.|:    |...::|:             |..|:..: 
  Fly  6383 ATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSRIYEADSRLKEIAHGRNVADVGDSLPIFTMR 6447

Mouse   166 ------QAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKR-----ETTISQLLI 219
                  |...|..|||:.. ..|...|:|::|          .||:...::     |.....|.|
  Fly  6448 LRDRRVQVTYPVRLTCQIV-GYPVPEILWYKD----------DELIHTDRKHLISAEGQFFTLEI 6501

Mouse   220 EPTDLDIGRVFTCRSMNE----------AIPNGKETSIELDVHHPPTVTLSIEPQTVL-EGERVI 273
            ..|.||....:||.:.||          .:..|....|..|.:.|      ::|..:. ||..:.
  Fly  6502 AATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVP------LDPFYIFREGSEIR 6560

Mouse   274 FTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCE-------VY-----NKVG 326
            .:.:..|.|.: |..|.:.|..:..:.  |....:|.:.:.|.:..|       :|     |.||
  Fly  6561 LSTKVEAYPSV-GVTWHRNGMRLRPSR--RLTATLDSNGYVELIIAEATVRDAGIYVCVASNVVG 6622

Mouse   327 STNVSTLVNVHFA--------------------------PRIVVYPKPTTTDIGSDVTLTCVWVG 365
            .......|.|..|                          |..||.|:.:....|.:|.:.|..||
  Fly  6623 KVETICRVAVEEAENKAVAPQRSLEIPSIKTDDLPYSKEPLFVVKPRSSEAYEGDNVIIFCEVVG 6687

Mouse   366 NPPLTLTWTK--------KDSNMGPRLPGSPPEANLSAQVLSNSNQLLLKSVTQADAGTYT---- 418
            :|...:.|.:        ||:....|: |..||..|.           :.|......|||:    
  Fly  6688 DPKPEVVWLRDFLNPEYYKDAPHFRRI-GDGPEYRLE-----------IPSAKLDFTGTYSVIAS 6740

Mouse   419 -CRAIVPRIGVAEREVPLYVNGPPIISS-------------EAVQFAVR---------GDGGKVE 460
             |.      |.|:..:.|.:....|::.             |.:...||         ||...:|
  Fly  6741 NCH------GEAKAVISLQIFAKDILNKSRMDKVHTRHGNIETLPRFVRNLRNLRCCDGDAISLE 6799

Mouse   461 CFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNS 525
            |.:.:.|.|..|   |:::...:.:...|.:    |..|..:||:|..|...| :..|.|.|.||
  Fly  6800 CHVEADPEPFII---WEKDGHVMPSDRDYVM----SFDGTKATLSIPRVYPED-EGEYTCVAKNS 6856

Mouse   526 FGPGTA----IIQL-EEREVL-------PVGIIAG-----ATIGAGILVVFSFAALVF------- 566
            .|...:    |:.: ||:|.:       |.|:::.     :|..:.....||...|.:       
  Fly  6857 VGRSLSSACIIVDVPEEKENMLSRQLARPSGLLSAHSTPRSTPRSTPARSFSPLRLSYRTSSIDL 6921

Mouse   567 --FLYRRRKGSRKDVTLRKLDIKVETVNREPLTMHSDR---EDDTASISTATRVMKAIYSSFKDD 626
              ...|||..:|..:|..|.           |.:..:|   |.|:.....|.......::::..|
  Fly  6922 SGVAERRRSDARNAITAPKF-----------LAIPYNRVVEEGDSVRFQCAISGHPTPWATWDKD 6975

Mouse   627 ---------VDLKQ--DLRCDTIDTREEYEMKDPTNGYYNVRAHED------------------- 661
                     :.:|:  |||...||     |:.....|.|.|....|                   
  Fly  6976 GLIVTPTPRIAVKEIDDLRIIEID-----EVTFDDAGLYRVTLENDFGRIEATARLDVIRSSRYS 7035

Mouse   662 -RPSSRAV----------LYADYRAPGPTRFDGRPSSRLSHSSGY 695
             .||.|:|          ||.  |..||:...|   .|::.:|||
  Fly  7036 KSPSVRSVRASSSRRNAHLYR--RIMGPSTAIG---GRMALASGY 7075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 27/93 (29%)
Ig2_KIRREL3-like 170..251 CDD:143236 22/95 (23%)
Ig 255..336 CDD:386229 17/93 (18%)
Ig_3 340..421 CDD:372822 23/93 (25%)
Ig5_KIRREL3 439..536 CDD:143306 27/123 (22%)
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:254352 27/93 (29%)
Ig 6328..6412 CDD:299845 27/93 (29%)
I-set 6442..6531 CDD:254352 22/99 (22%)
Ig 6459..6528 CDD:143165 19/79 (24%)
I-set 6541..6632 CDD:254352 19/99 (19%)
IGc2 6555..6622 CDD:197706 13/69 (19%)
I-set 6662..6754 CDD:254352 26/109 (24%)
Ig 6679..6751 CDD:143165 20/89 (22%)
I-set 6779..6868 CDD:254352 24/96 (25%)
IGc2 6793..6858 CDD:197706 21/72 (29%)
Ig 6938..7022 CDD:299845 18/99 (18%)
I-set 6939..7028 CDD:254352 18/104 (17%)
IG 7075..7140 CDD:214652 1/1 (100%)
Ig 7075..7140 CDD:143165 1/1 (100%)
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.