DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr19

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:185 Identity:44/185 - (23%)
Similarity:74/185 - (40%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    25 LSQKMWAPHLVVAYLIFVTLALA----LPGTQTRFSQEPADQ-------TVVA--GQRAVLPCVL 76
            :..|.|..|| ..:|:.::...:    :..:|..|......|       .|:|  |..|:||||:
  Fly     1 MEPKRWHLHL-SCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVV 64

Mouse    77 -LNYSGIVQW--TKDGLALGMGQGL-KAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEA 137
             :|....|.|  .||...|.:|... .:..|:.|..:...|.::|.|......|...||||.:..
  Fly    65 KVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIY 129

Mouse   138 ALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFNA-KPAATIIWFRD 191
            ..:|...:|.::....|  |...|.:.:...:...|.|:...| :..|.:.|:.|
  Fly   130 PTQSIVIELKIVEAVAE--ISSAPELHIDETSTLRLECKLKRATENPAFVFWYHD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 29/106 (27%)
Ig2_KIRREL3-like 170..251 CDD:143236 6/23 (26%)
Ig 255..336 CDD:386229
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/76 (33%)
IGc2 55..125 CDD:197706 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.