DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr4

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:238 Identity:59/238 - (24%)
Similarity:98/238 - (41%) Gaps:64/238 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    52 QTRFSQEPADQ------TVVAGQRAVLPCVLLNYS-----------------GIVQWTKDGLALG 93
            :|.:||...|.      |...||.|:|.|.:.|..                 ||:.:|.|     
  Fly    39 ETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTND----- 98

Mouse    94 MGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEETRID 158
                    .|::.:.|..:.::.|.|:..:..|..:||||.:.....|:..:|.|::  ...:|.
  Fly    99 --------QRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV--SRAKIL 153

Mouse   159 GGPVILLQAGTPYNLTCRAFNAK-PAATIIWFR-----DGTQQEGAVTSTELLKDGKRETTISQL 217
            |...:.:::|:..||||.|..:. |.:.|.|::     :.:|:.|....||      |.|..|:|
  Fly   154 GNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITE------RSTRTSKL 212

Mouse   218 LI-EPTDLDIGRVFTCRSMNEAIPNGKETSIELDVH-----HP 254
            || :.|..|.|. :||.      |:..: |..:.||     ||
  Fly   213 LIAKATPADSGN-YTCS------PSSSD-SASVVVHVINGEHP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 25/116 (22%)
Ig2_KIRREL3-like 170..251 CDD:143236 25/87 (29%)
Ig 255..336 CDD:386229 59/238 (25%)
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
dpr4NP_001014616.2 V-set 53..146 CDD:284989 22/105 (21%)
IG_like 53..145 CDD:214653 22/104 (21%)
ig 153..227 CDD:278476 23/80 (29%)
IG_like 161..>227 CDD:214653 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.