DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr18

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:301 Identity:59/301 - (19%)
Similarity:102/301 - (33%) Gaps:97/301 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse   173 LTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTIS-------QLLIEPTDLDIGRVF 230
            |.||....|. .|::|.|...::...:|...:...|.....:.       :|||.||..:...|:
  Fly   244 LNCRVGMLKD-KTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVY 307

Mouse   231 TCRSMNEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGE-RVIFTCQATANPEILGYRWAKGGF 294
            .|               ::..|.|...|.::   ||||.. |:|     ..:...:|.|:.|.|.
  Fly   308 MC---------------QVSTHPPRVFTTNL---TVL
EPPLRII-----DEHERDVGDRYYKSGS 349

Mouse   295 LIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTN--VSTLVNVHFAPRIVVYPKPTTTDIGSDV 357
            .::      .:..:..|||.:... .:.....|.|  |..|:|            .||:::.   
  Fly   350 TVD------LQCQISRSFFQKERQ-TILKSTDSANDAVQKLIN------------ETTSELN--- 392

Mouse   358 TLTCVWVGNPPLT----------------LTWTKKDSNMGPRLPGSPPEANLSAQVLSNSNQLLL 406
                 .:||...|                :||.|.:.          |...::.:.||.|:..|.
  Fly   393 -----LIGNVNQTQHKFSGQDLEKYFTKFITWAKDEE----------PLQGMTNRRLSVSDVWLT 442

Mouse   407 KSVTQADA-----GTYTCR-----AIVPRIGVAEREVPLYV 437
            ..::..||     |.|:|.     .::.::.|...|:|..|
  Fly   443 SRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229
Ig2_KIRREL3-like 170..251 CDD:143236 16/84 (19%)
Ig 255..336 CDD:386229 18/83 (22%)
Ig_3 340..421 CDD:372822 18/106 (17%)
Ig5_KIRREL3 439..536 CDD:143306
dpr18NP_573102.1 IG_like 242..325 CDD:214653 19/99 (19%)
Ig <258..326 CDD:299845 15/85 (18%)
IGc2 <417..461 CDD:197706 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.