DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr8

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:281 Identity:68/281 - (24%)
Similarity:105/281 - (37%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    33 HLVVAYLIFVTLALALPGTQTRFSQE------------PADQTVV-------AGQRAVLPCVLLN 78
            |.::...|...||....|...||..:            |...|.:       .|:...|.|.:.|
  Fly     4 HWIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKN 68

Mouse    79 YSG-IVQWT--KDGLALGMGQ-GLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL 139
            ... .|.|.  :|...|.:|: ...:..|:..:.|..|..:.|.|..|:..|...||||.:....
  Fly    69 LGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPP 133

Mouse   140 RSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRA-FNAKPAATIIWFRD------GTQQEG 197
            ......|.::.|  .|.|.|||.:.:..|:..||||.. |..:|..|:||..:      .:.:.|
  Fly   134 IGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGG 196

Mouse   198 AVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTV----- 257
            ....||     |...|.|:||::........::||...| |.|......| :|..||..:     
  Fly   197 ISLVTE-----KGVLTTSRLLVQKAITQDSGLYTCTPSN-ANPTSVRVHI-VDGEHPAAMHTGNN 254

Mouse   258 --TLSIEPQTVLEGERVIFTC 276
              :.:.:|..:|  ..|:.||
  Fly   255 GNSTASQPPVLL--PLVLLTC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 25/116 (22%)
Ig2_KIRREL3-like 170..251 CDD:143236 23/87 (26%)
Ig 255..336 CDD:386229 5/29 (17%)
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 20/79 (25%)
V-set 52..143 CDD:284989 21/90 (23%)
IG_like 153..238 CDD:214653 24/90 (27%)
ig 153..232 CDD:278476 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.