DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and DIP-alpha

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:348 Identity:84/348 - (24%)
Similarity:138/348 - (39%) Gaps:60/348 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 LVVAYLIFVTLALALPGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGI-VQWTK-DGLALGMGQ 96
            :::..|:.|:|..|:...|..|.:..::.:|..|:.|...|.:.:..|. |.|.| |..|:   |
  Fly    23 MLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAI---Q 84

Mouse    97 GLKA-----WPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEETR 156
            .:..     .||. .|...|...:||.|......|...|.||.....::|:...|.|:|||:...
  Fly    85 AIHENVITHNPRV-TVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFIS 148

Mouse   157 IDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFR-DGTQ---QEGAVTST-------ELLKDGKR 210
            .|....:::..|:...||||| ...|...:.|.| ||.:   ::...|.|       |:||..| 
  Fly   149 EDTSSDVIVPEGSSVRLTCRA-RGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSK- 211

Mouse   211 ETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGERVIFT 275
               ||:       .::|. :.|.:.| .:|......|.|.:|..|.:.:..:......|..|...
  Fly   212 ---ISR-------NEMGS-YLCIASN-GVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIE 264

Mouse   276 CQATANPEILGYRWAK---------GGFLIEDAHESRYETNVDY---SFFTEPVS---CEVYNKV 325
            |...|:|:.:.| |.|         |.:.::::.:|.|||.:..   .|..:.|.   |...|.:
  Fly   265 CHVEASPKSINY-WIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSL 328

Mouse   326 GSTNVSTLVNVHFAPRIVVYPKP 348
            |..:.|.        |:...|.|
  Fly   329 GEVDSSI--------RLYEIPGP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 25/100 (25%)
Ig2_KIRREL3-like 170..251 CDD:143236 24/91 (26%)
Ig 255..336 CDD:386229 20/95 (21%)
Ig_3 340..421 CDD:372822 3/9 (33%)
Ig5_KIRREL3 439..536 CDD:143306
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/83 (27%)
Ig 51..131 CDD:299845 22/83 (27%)
I-set 144..240 CDD:254352 27/109 (25%)
IGc2 159..228 CDD:197706 22/82 (27%)
Ig 244..337 CDD:299845 20/101 (20%)
I-set 244..337 CDD:254352 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.