DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel1 and rst

DIOPT Version :10

Sequence 1:XP_011238330.1 Gene:Kirrel1 / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_525058.2 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:141 Identity:30/141 - (21%)
Similarity:57/141 - (40%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse   196 KHDTELYMHLNRLEIPPQIYGLRWVRLLFGR--EFPLQDLLVVWDALFADGLHLSLVDYVFTAML 258
            |:|.||....|.:...   .|.:::|.:..|  ..|:::|:.|      .|.|..    ||.|..
  Fly    92 KNDPELKNGYNAIGFS---QGA
QFLRAVAQRCPNPPMKNLVSV------GGQHQG----VFGAPY 143

Mouse   259 LYIRDALISSNYQTCLGLLMHYPLIGDIHSLILKALFLRDPKRNPRPVTYQFHPNLDYYKARG-- 321
            . |.|.::.:..:..:.|..:.|.   :...:::|.:..||.:            ::.||.|.  
  Fly   144 C-IGDNIMCNGVRRLIDLGAYLPF---VQKRVVQAQYWHDPNQ------------VEEYKKRSIF 192

Mouse   322 -ADLMNKSRTN 331
             ||:.|::..|
  Fly   193 LADINNENNNN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel1XP_011238330.1 Ig 54..148 CDD:472250
Ig strand B 70..74 CDD:409353
Ig strand C 83..86 CDD:409353
Ig strand E 110..119 CDD:409353
Ig strand F 129..134 CDD:409353
Ig strand G 141..144 CDD:409353
IgI_2_KIRREL3-like 154..251 CDD:409416 13/56 (23%)
Ig strand A 155..158 CDD:409416
Ig strand A' 161..165 CDD:409416
Ig strand B 172..179 CDD:409416
Ig strand C 184..189 CDD:409416
Ig strand C' 192..194 CDD:409416
Ig strand D 197..204 CDD:409416 3/6 (50%)
Ig strand E 211..219 CDD:409416 1/7 (14%)
Ig strand F 228..236 CDD:409416 2/7 (29%)
Ig strand G 242..248 CDD:409416 2/5 (40%)
Ig_3 254..>314 CDD:464046 9/59 (15%)
Ig_3 340..421 CDD:464046
IgI_5_KIRREL3 439..536 CDD:409479
Ig strand A 440..444 CDD:409479
Ig strand A' 446..449 CDD:409479
Ig strand B 457..464 CDD:409479
Ig strand C 471..476 CDD:409479
Ig strand C' 478..481 CDD:409479
Ig strand D 489..496 CDD:409479
Ig strand E 499..506 CDD:409479
Ig strand F 517..524 CDD:409479
Ig strand G 527..534 CDD:409479
rstNP_525058.2 Ig 29..110 CDD:472250 5/20 (25%)
Ig strand B 45..49 CDD:409353
Ig strand E 90..94 CDD:409353 1/1 (100%)
Ig strand F 104..109 CDD:409353 0/7 (0%)
C2-set_2 135..225 CDD:400489 18/89 (20%)
Ig strand B 151..155 CDD:409353 0/3 (0%)
Ig strand C 165..169 CDD:409353 1/6 (17%)
Ig strand E 197..201 CDD:409353 1/3 (33%)
Ig strand F 211..216 CDD:409353
Ig strand G 226..229 CDD:409353
Ig 271..340 CDD:472250
Ig_3 346..411 CDD:464046
Ig 428..524 CDD:472250
Ig strand B 446..450 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 491..495 CDD:409353
Ig strand F 505..510 CDD:409353
Ig strand G 518..521 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.