DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel and dpr9

DIOPT Version :9

Sequence 1:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:219 Identity:55/219 - (25%)
Similarity:87/219 - (39%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 TVVAGQRAVLPCVLLNYSG-----IVQWT--KDGLALGMGQ-GLKAWPRYRVVGSADAGQYNLEI 119
            |.:.|:.|.|.|.:.|...     .|.|.  :|...|.:|: ...:..|:|.:.......:.|:|
  Fly   267 TALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQI 331

Mouse   120 TDAELSDDASYECQATEAALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFNA-KPA 183
            ...:..|...||||.:.....|....|.|:.|  .|.|.|.|.:.:::|:..||||...|: :|.
  Fly   332 KYPQHRDSGIYECQVSTTPHMSHYIHLNVV
EP--STEIIGAPDLYIESGSTINLTCIIQNSPEPP 394

Mouse   184 ATIIWFRDGT-----------QQEGAVTSTELLKDGKRETTISQLLIE---PTDLDIGRVFTC-- 232
            |.|.|..:..           ...|.|:    :...|.:||.|.|||:   |:|   ...:.|  
  Fly   395 AYIFWNHNNAFPSHPQIINYDSPRGGVS----VVTNKGDTTTSFLLIKSARPSD---SGHYQCNP 452

Mouse   233 -----RSMNEAIPNGKETSIELDV 251
                 :|:...:.||...|:...|
  Fly   453 SNAKPKSVTVHVLNGVSHSVSRGV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KirrelXP_011238330.1 Ig 54..148 CDD:386229 22/92 (24%)
Ig2_KIRREL3-like 170..251 CDD:143236 25/102 (25%)
Ig 255..336 CDD:386229
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
dpr9NP_001287332.1 Ig 263..361 CDD:299845 22/93 (24%)
IG_like 263..360 CDD:214653 22/92 (24%)
IG_like 371..464 CDD:214653 24/99 (24%)
IGc2 377..456 CDD:197706 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.