Sequence 1: | XP_011238330.1 | Gene: | Kirrel / 170643 | MGIID: | 1891396 | Length: | 805 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287332.1 | Gene: | dpr9 / 2768670 | FlyBaseID: | FBgn0038282 | Length: | 602 | Species: | Drosophila melanogaster |
Alignment Length: | 219 | Identity: | 55/219 - (25%) |
---|---|---|---|
Similarity: | 87/219 - (39%) | Gaps: | 39/219 - (17%) |
- Green bases have known domain annotations that are detailed below.
Mouse 63 TVVAGQRAVLPCVLLNYSG-----IVQWT--KDGLALGMGQ-GLKAWPRYRVVGSADAGQYNLEI 119
Mouse 120 TDAELSDDASYECQATEAALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFNA-KPA 183
Mouse 184 ATIIWFRDGT-----------QQEGAVTSTELLKDGKRETTISQLLIE---PTDLDIGRVFTC-- 232
Mouse 233 -----RSMNEAIPNGKETSIELDV 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kirrel | XP_011238330.1 | Ig | 54..148 | CDD:386229 | 22/92 (24%) |
Ig2_KIRREL3-like | 170..251 | CDD:143236 | 25/102 (25%) | ||
Ig | 255..336 | CDD:386229 | |||
Ig_3 | 340..421 | CDD:372822 | |||
Ig5_KIRREL3 | 439..536 | CDD:143306 | |||
dpr9 | NP_001287332.1 | Ig | 263..361 | CDD:299845 | 22/93 (24%) |
IG_like | 263..360 | CDD:214653 | 22/92 (24%) | ||
IG_like | 371..464 | CDD:214653 | 24/99 (24%) | ||
IGc2 | 377..456 | CDD:197706 | 22/85 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |