DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhrs9 and Adhr

DIOPT Version :9

Sequence 1:NP_570832.1 Gene:Dhrs9 / 170635 RGDID:620655 Length:319 Species:Rattus norvegicus
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:279 Identity:53/279 - (18%)
Similarity:99/279 - (35%) Gaps:109/279 - (39%)


- Green bases have known domain annotations that are detailed below.


  Rat    26 DIADKYI-FITGCDSGFGNLAARTFDRKGFRVIAACLTESGSEALKAKTSERLHTVLLDVTNP-- 87
            |:..|:: ::..|    |.:|..|                 |:.|..|...:| .:|....||  
  Fly     3 DLTGKHVCYVADC----GGIALET-----------------SKVLMTKNIAKL-AILQSTENPQA 45

  Rat    88 ----ENVKETAQ---W----------VKSHVGEKGLWGLINNAGVLGVLAPTDWLTV-------- 127
                :::|.:.|   |          :|.:..|              |:...|::.|        
  Fly    46 IAQLQSIKPSTQIFFWTYDVTMAREDMKKYFDE--------------VMVQMDYIDVLINGATLC 96

  Rat   128 --DDYREPIEVNLFGLINVTLNMLPLVKK----ARGRVINVSSIGG---RLAFGGGGYTPSKYAV 183
              ::....|..||.|::|....:||.:.:    ..|.::||:|:.|   ...|  ..|:.||:.|
  Fly    97 DENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVF--CAYSASKFGV 159

  Rat   184 EGFNDSLRRDMKAFGVHVSCIEPGLFKTGLADPIKTTEKKLAIWK--------HLSPDIKQ--QY 238
            .||..|                       ||||:..::..:|:..        .:..::|.  :|
  Fly   160 IGFTRS-----------------------LADPLYYSQNGVAVMAVCCGPTRVFVDRELKAFLEY 201

  Rat   239 GEGYIEKSLHRLKSSTSSV 257
            |:.:.:: |.|....::||
  Fly   202 GQSFADR-LRRAPCQSTSV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhrs9NP_570832.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 52/275 (19%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 52/275 (19%)
adh_short 7..195 CDD:278532 45/248 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.